KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01283Help
Entry
KNP414_01283      CDS       T01550                                 

Gene name
mdh
Definition
(GenBank) Mdh
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00020  Citrate cycle (TCA cycle)
pms00270  Cysteine and methionine metabolism
pms00620  Pyruvate metabolism
pms00630  Glyoxylate and dicarboxylate metabolism
pms00680  Methane metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pms_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KNP414_01283 (mdh)
   00620 Pyruvate metabolism
    KNP414_01283 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    KNP414_01283 (mdh)
  Energy metabolism
   00680 Methane metabolism
    KNP414_01283 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KNP414_01283 (mdh)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     KNP414_01283 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C DAO UDPG_MGDP_dh_N NAD_binding_8 Glyco_hydro_4 3HCDH_N Pyr_redox_2 Shikimate_DH DUF1188
Motif
Other DBs
NCBI-ProteinID: AEI39848
UniProt: F8FHE6
Position
1290724..1291665
Genome map
AA seq 313 aa AA seqDB search
MAIQRKKITVVGAGFTGATTALMLAQKELGDVVLLDIPQLENPTKGKALDMLEASPVQGF
DAKIIGTSSYDDSASSDIVIITAGIARKPGMSRDDLVNTNAGIVKSVCENIKRTSPQSIV
IILSNPVDAMTYVAFETLGFPKNRVIGQSGVLDTARYCTFIAQELNVSVEDVRGFVLGGH
GDDMVPLVRYSNVGGIPIEKLIPADRIDAIVKRTRTGGGEIVNLLGNGSAYYAPAASLVQ
MTEAILKDKKRIIPAIALLQGEYGYDNLFMGVPTLLGGDGIEKVFELELLPEEKAALDKS
AESVRNVTKVVTG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctatccaacggaagaagattacggttgtgggcgccggtttcaccggcgcaacgaca
gctctgatgcttgcacaaaaagaactcggtgacgtagtgctgctcgacattccgcagctc
gagaatccgaccaaagggaaggcgctcgacatgctcgaggcttccccggtgcagggattc
gacgccaagatcatcggtacgtcttcgtatgacgattccgcgagctccgacatcgtgatc
atcacggcgggaatcgcacggaaaccgggcatgagccgcgacgatctcgtgaatacgaat
gccggcatcgtgaagtccgtatgtgagaacatcaagagaacgtctccacagtcgatcgtc
atcattctctccaacccggtggatgcgatgacgtacgtcgcattcgagacgctgggcttc
ccgaagaaccgcgtcatcggccagtccggtgtgcttgacaccgcacgctactgcaccttc
atcgcgcaagaactgaatgtgtccgtagaagacgttcgcggcttcgttctcggcggccac
ggtgacgacatggtaccgcttgtccgttactccaacgtcggcgggattccgatcgagaag
ctgatcccggcggaccgcatcgacgcgatcgtgaagcgtacgcgcaccggcggaggcgag
atcgtcaacctgctcggcaacggttccgcctactacgctcccgcggcatcgctcgttcaa
atgacggaagcgatcctgaaggacaagaagcggatcattcctgcgatcgctctgctccaa
ggcgagtacggctacgacaacctgttcatgggcgttcctacgctgctcggcggcgacggc
atcgagaaagtattcgagctcgagctgctgccggaagagaaggccgccctggataagtcg
gctgaatccgttcgcaatgtcaccaaagtggtaacgggctga

DBGET integrated database retrieval system