KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01507Help
Entry
KNP414_01507      CDS       T01550                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00052  Galactose metabolism
pms00500  Starch and sucrose metabolism
pms00520  Amino sugar and nucleotide sugar metabolism
pms00521  Streptomycin biosynthesis
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pms_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_01507
   00052 Galactose metabolism
    KNP414_01507
   00500 Starch and sucrose metabolism
    KNP414_01507
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_01507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KNP414_01507
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KNP414_01507
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KNP414_01507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEI40071
UniProt: F8FMI8
Position
1526284..1527255
Genome map
AA seq 323 aa AA seqDB search
MSRYIGIDIGGTNMVCGLTDGEGQVLRTVKIVTEAPSGSKEVIRRLAEAVTGLMTHAGGQ
VSAVGIGLPGFVDHVQGISELAVNLGWKNVPLADELRGHIGDIPVFLDNDVRMYVYGEAV
AGAGRGFSHVLGVTIGTGMNSALVADGELYYGAGGRAGEIGHVPMEGLTYPCNCGMTGCL
ETAVSANGIARQGREAVARGERSLLGEWFPEDGGARLTAADVSRAYDLGDAAAAAILRRT
GTLLGRGLAAAVTQLAPQVLIIGGGGAQAGERLLGPMKEELKRCVLPFYWEQLTVKTAER
LEDAGVVGSALYAKGRLEAQAQQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaggtatataggtatcgatatcggcggaacgaatatggtatgcgggttgacggac
ggggaggggcaggtgctgcgcacggtcaagattgtgacggaggccccgagcgggagcaaa
gaagtgatccgccggctggccgaggcggtgaccgggctgatgacccatgcaggcggacag
gtgtcagccgtggggatcggtcttcccgggttcgtggaccatgtccaggggatctccgag
ctggcggtgaatctcggctggaagaacgtgcctctggcggacgagctgcgggggcatatc
ggtgacattccggtattcctcgataacgacgtgcggatgtacgtctacggcgaagccgtg
gcgggagcgggccggggcttctcgcacgtgctcggcgtaacgatcggcactggcatgaac
tcggcgctggtggcggacggcgagctgtactacggcgccggcggacgggccggagagatc
gggcacgtgccgatggaagggctgacctacccgtgcaactgcgggatgaccgggtgtctc
gagacggccgtctccgcgaacggcatcgcccgtcagggacgcgaagccgtggcccggggg
gaacggtcgctgctcggcgaatggttcccggaggacgggggagcgcgcctgacagcggcc
gacgtctcgcgggcctatgatctgggcgatgcggcggcggccgccatcctgcggcggacg
ggaacgctgctcggccgcggacttgcggcagccgtgacccagctggccccgcaggtgctg
atcatcggaggaggcggagcgcaggccggagagcggctgctcggccccatgaaggaggag
ctgaagcgctgcgtgctgccgttctactgggagcagcttacggtcaagacagccgaacgg
ctggaggatgccggggtcgtcggaagcgctctgtacgcgaagggcagactggaagcgcag
gcacagcagtag

DBGET integrated database retrieval system