KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01595Help
Entry
KNP414_01595      CDS       T01550                                 

Gene name
pfkA
Definition
(GenBank) PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00030  Pentose phosphate pathway
pms00051  Fructose and mannose metabolism
pms00052  Galactose metabolism
pms00680  Methane metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
pms01230  Biosynthesis of amino acids
pms03018  RNA degradation
Module
pms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pms_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_01595 (pfkA)
   00030 Pentose phosphate pathway
    KNP414_01595 (pfkA)
   00051 Fructose and mannose metabolism
    KNP414_01595 (pfkA)
   00052 Galactose metabolism
    KNP414_01595 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KNP414_01595 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KNP414_01595 (pfkA)
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KNP414_01595 (pfkA)
Protein phosphatases and associated proteins [BR:pms01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KNP414_01595 (pfkA)
Messenger RNA biogenesis [BR:pms03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KNP414_01595 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEI40159
UniProt: F8FNP7
Position
1609176..1610141
Genome map
AA seq 321 aa AA seqDB search
MSVKKIAVLTSGGDSQGMNAAVRAVVRSGLFHGLEVFAVQRGYAGLINDDIRPMDLRSVG
DIIQRGGTVLQTARCKEFLTPEGQQLGADNLRKHGIDGLVVIGGDGSYQGANKLSKLGIK
TMGLPGTIDNDIPFTDFTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIAL
YAGLASGAETIIVPEVGYDMDEISNRMAENFAQGKRHSIIIVAEGVCGGDEIAAEITKRN
GIEPRVTVLGHIQRGGAPTHNDRILASSLGDFAVRKLIEGDSGKACGIIKGELTVTDIDK
VVNTKKPFNMELYELAKRLSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaagattgcagtactcaccagcggcggcgattcccaggggatgaacgca
gccgtccgcgccgttgtgcgcagcggcctgttccacggcctcgaagtgttcgccgtccag
cgcggttacgcgggcctgatcaacgatgacatccgtccgatggacctgcgcagcgtcggc
gatattatccagcgcggcggcacggtgctccagacggctcgctgtaaggagttcctgaca
ccggaaggacagcagctcggcgcggacaacctgcgcaagcacggcatcgacggactcgtc
gtgatcggcggggacggctcgtaccagggcgcgaacaagctcagcaagctcggcatcaag
acgatgggcctgccgggcaccatcgacaacgacatcccgttcacggacttcacgatcggc
ttcgatacggcggtctccatcgtggtcgatgcgatcaacaagctgcgtgatacgatgagc
tcgcatgagcgttcgtccatcgtggaagtcatgggccgccactgcggcgacatcgccctg
tatgcgggccttgcgagcggtgcggagacgatcatcgtgccggaagtcggctacgatatg
gacgagatctcgaaccggatggcagagaacttcgcccagggcaagcgccacagtatcatc
atcgtggcggaaggggtctgcggcggcgacgagatcgcggcggagatcaccaagcgcaac
ggcatcgagccgcgcgtaaccgtgctcggccatattcagcgcggcggtgcgccgacgcat
aatgaccggatcctcgcgagcagcctcggcgacttcgccgtgcgcaagctgatcgagggc
gactcgggcaaggcctgcggcatcatcaagggcgagctgaccgtgaccgacatcgacaag
gtcgtcaacacgaagaagccgttcaacatggagctgtacgagctcgcgaagcgtctgtcc
caataa

DBGET integrated database retrieval system