KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02584Help
Entry
KNP414_02584      CDS       T01550                                 

Gene name
atoB2
Definition
(GenBank) AtoB2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00071  Fatty acid degradation
pms00072  Synthesis and degradation of ketone bodies
pms00280  Valine, leucine and isoleucine degradation
pms00310  Lysine degradation
pms00362  Benzoate degradation
pms00380  Tryptophan metabolism
pms00620  Pyruvate metabolism
pms00630  Glyoxylate and dicarboxylate metabolism
pms00640  Propanoate metabolism
pms00650  Butanoate metabolism
pms00900  Terpenoid backbone biosynthesis
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
pms01212  Fatty acid metabolism
pms02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KNP414_02584 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    KNP414_02584 (atoB2)
   00640 Propanoate metabolism
    KNP414_02584 (atoB2)
   00650 Butanoate metabolism
    KNP414_02584 (atoB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KNP414_02584 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    KNP414_02584 (atoB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KNP414_02584 (atoB2)
   00310 Lysine degradation
    KNP414_02584 (atoB2)
   00380 Tryptophan metabolism
    KNP414_02584 (atoB2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KNP414_02584 (atoB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KNP414_02584 (atoB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KNP414_02584 (atoB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pms04147]
    KNP414_02584 (atoB2)
Enzymes [BR:pms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KNP414_02584 (atoB2)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KNP414_02584 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEI41145
UniProt: F8FAQ6
Position
2737425..2737760
Genome map
AA seq 111 aa AA seqDB search
MMGLGPVDAVRRLVQKTGVALDSVELFELNEAFAAQSLAVMRELGVPADRVNVNGGAIAL
GHPIGASGARVLVTLLHELARREARYGIAALCIGGGQGVAMLVEWVEQSAG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggactcgggcctgtcgacgccgtgcgccggctcgtgcagaagacgggcgtggcg
ctggactcggtggagctcttcgagctcaacgaggcgttcgccgcccagtccctggccgtc
atgcgcgagctgggcgtgcccgcggaccgcgtgaacgtcaacggcggcgccatcgccctc
ggccacccgatcggggctagcggagcccgcgtgctcgtcacgctgctgcacgagctagcc
cggcgggaggcgcgctatggcatcgccgcgctgtgtatcggcggcggccagggcgttgcg
atgctcgtggagtgggtggagcagagcgcggggtag

DBGET integrated database retrieval system