KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02856Help
Entry
KNP414_02856      CDS       T01550                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00260  Glycine, serine and threonine metabolism
pms00750  Vitamin B6 metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01230  Biosynthesis of amino acids
Module
pms_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KNP414_02856
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KNP414_02856
Enzymes [BR:pms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KNP414_02856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF1646
Motif
Other DBs
NCBI-ProteinID: AEI41415
UniProt: F8FCZ8
Position
2984066..2985460
Genome map
AA seq 464 aa AA seqDB search
MNFISTRGKTAGIGFIDTVLMGLADDGGLLIPNEIPHISAARLKEMESLSYQDLAYEVFS
YYTNNEIPDEDLKDLIRQSYATFRDPEVTPVKKLTDNMYVMELFHGPTFAFKDVALQFLG
NLYAYVSKKQNEIIHILGATSGDTGASAIEGVRGKEGIRICILHPHQKVSRVQELQMTTV
DDENVLNLSVEGTFDDCQRIIKDLFADVPFKTKYHLRAINSINFVRILAQTVYYFYAYFR
VQKDKPGAKVNFSVPTGNFGDIFAGYLAKRMGLPVNKLILATNENNILERFVLEGVYRPG
EFKSTHSPSMDIQVASNFERYLYYLLGENPQQAAAYMEGFKTDGVITIAPELLSRVQADF
AAHGVGGEECLATIGSYYREHGYLLDPHTACGVAAYEKCSPAEEVCVTLSTAHPAKFNES
IELVGIEQTYPQPIQDLFAKPQHQEIVDSSVEEIVRRLESFYTK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattagcactaggggcaaaacagcaggaatcggatttatcgatacggtattg
atgggtctcgccgatgacggcggcctgctcattccaaacgaaattccgcacatctcggca
gccaggctgaaagaaatggagagcctcagctaccaggatctggcttatgaggtgttctcg
tattatacgaataacgaaattcccgatgaagatctgaaggatctgatccggcagagctat
gcgaccttccgtgatccggaagtgacgccggtgaagaaactcacggacaatatgtacgta
atggagctcttccacgggcctaccttcgcgttcaaggacgtggccctgcagttcctaggc
aacctgtacgcgtacgtgtcgaagaagcagaacgagatcattcacatcctgggggctact
tccggtgataccggcgcttcggccatcgaaggcgtccggggcaaggaaggcatccgcatc
tgcattcttcacccgcatcagaaggtcagccgggtgcaggagctgcaaatgacgaccgtt
gacgacgagaacgtgctgaacctctcggtggaaggcaccttcgacgactgccagcgcatc
atcaaggatctgttcgccgacgtgccgttcaagacgaaataccacctgcgcgcgatcaac
tcgatcaactttgtgcgcatcctggcccagactgtgtactacttctacgcttacttccgc
gtgcagaaggataagccgggcgcgaaggtgaacttcagcgtgccgacgggcaacttcggc
gacatcttcgcgggctatctcgcgaagcggatgggcctgccggtgaacaagctgatcctc
gcgacaaacgagaacaacatcctggagcgcttcgtcctcgaaggcgtataccgtccgggc
gagttcaagagcacgcacagcccatcgatggacattcaggtggcgagcaatttcgagcgg
tacctgtactatctgctcggggagaacccgcagcaggctgccgcctacatggaaggcttc
aagacggacggcgtgattacgatcgctcccgagctgctcagccgggtgcaggcggacttt
gctgcccacggcgtgggcggcgaggagtgcctggcgaccatcggcagctactaccgcgag
cacgggtacctgctggatccgcacacggcgtgcggtgtggcggcttatgagaagtgcagc
ccggcggaggaagtgtgcgtaaccttgtcaacggcccacccggcgaagttcaacgagtcc
atcgagctcgtgggcatcgagcagacgtacccgcagccgatccaggacctgttcgcgaag
ccgcagcaccaggagatcgtcgattcctcggtggaggagattgtccgccgcctggagagc
ttctatacgaaataa

DBGET integrated database retrieval system