KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04362Help
Entry
KNP414_04362      CDS       T01550                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00360  Phenylalanine metabolism
pms00362  Benzoate degradation
pms00620  Pyruvate metabolism
pms00621  Dioxin degradation
pms00622  Xylene degradation
pms00650  Butanoate metabolism
pms01100  Metabolic pathways
pms01120  Microbial metabolism in diverse environments
pms01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KNP414_04362
   00650 Butanoate metabolism
    KNP414_04362
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KNP414_04362
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KNP414_04362
   00622 Xylene degradation
    KNP414_04362
   00621 Dioxin degradation
    KNP414_04362
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KNP414_04362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Shikimate_DH Glu_dehyd_C GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEI42894
UniProt: F8FJP4
Position
complement(4591672..4592568)
Genome map
AA seq 298 aa AA seqDB search
MRRNSDRLKAAILGTGNIGTDLLVKILQSKYLECTYFIGRNRDSHGLSLAGSWGVRTSHQ
SIRAIQEDPDCCDLVFDATSARDHLLHAPILKKLGKTVIDLTPARIGTMCIPAINLEACV
GKSNINMVTCGGQSSVPLAHAIGQTHSEVEYIEVVSTVASKGAGPATRINLDEYIETTES
CIRQFSGSRQSKTILNLNPAEPCIDMQSTLLAKVKNPSMEQLTKLVNETAANIRQYVPGY
QLIMPPTFKEGHIQMMIRVQGRGDYLPPYAGNLDIINCAAVATAERLAKARLTEGVVH
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaaatagcgataggctgaaagcggccattctgggaacgggcaatatcggaacc
gatcttctcgtcaaaatcctgcagtcgaaatacctggagtgcacgtattttatcggacgc
aaccgtgattcccacgggctgtcgctggctggcagctggggggtacgtacctcccaccaa
agcatccgtgcgatccaggaggacccggactgctgtgatcttgtgttcgatgcgacatcg
gcgcgcgatcatctgctgcatgccccgattcttaagaagctggggaaaacggtgattgat
ctgacgcccgcgaggatcggtaccatgtgcattccggccatcaatctggaggcatgtgtg
gggaagagcaatatcaacatggtgacctgcggcggacaatcgtccgtcccgctggcccat
gccatcggtcagacgcattcggaggttgaatatatcgaagtggtatccaccgtcgcttcc
aagggggcgggacctgccacccgcatcaacctggacgaatatatcgaaacgacggaaagc
tgcatccggcagttctcgggaagccggcagagcaagaccatcctgaacctgaacccggca
gagccgtgcatcgatatgcagtcgaccctgctggccaaagtgaaaaacccgtccatggag
cagttaaccaaactcgttaacgaaacggcagcaaacattaggcagtatgtaccgggttat
cagctgatcatgcccccaaccttcaaagagggccacatccaaatgatgatcagagttcag
ggccgcggagattatttgcccccttatgccggtaatctggacatcatcaattgtgcggct
gtcgccaccgctgaacggcttgcgaaggcacgcctgacggaaggagtggtccactaa

DBGET integrated database retrieval system