KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06234Help
Entry
KNP414_06234      CDS       T01550                                 

Gene name
rocF2
Definition
(GenBank) RocF2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00220  Arginine biosynthesis
pms00330  Arginine and proline metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01130  Biosynthesis of antibiotics
pms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KNP414_06234 (rocF2)
   00330 Arginine and proline metabolism
    KNP414_06234 (rocF2)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KNP414_06234 (rocF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEI44756
UniProt: F8FK75
Position
complement(6861406..6862323)
Genome map
AA seq 305 aa AA seqDB search
MLMKLATNQRDISLIGVPLQLGADRAGVELGPHALRTSNIQQRLEYLGHRVHDTGDIHVN
RLDPCAPGEKLKYLAEIARVNAELAQRVAAEMGRGHFPLVIGGDHSVAIGTIKGVLQHVN
RLGVIWFDAHPDVNTEETTGSGNIHGMSLAVMLGYGHKSLISIGGEQAKINPRNVVIIGA
RSIDPGERIFLREQGIRVFTMHEIDKYGMRAVMDEAMERVTDGTDGVHLSLDLDGMDPQE
APGVGTPVSGGITYRESHYAMETLYESGALVSAEIVEVNPMLDIGNKTARAAVELAGSVF
GERIL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaagcttgccacaaaccaacgggacatttcactgatcggcgtgccgcttcag
ctcggggcggaccgggcgggtgtcgagcttggcccccatgccctgcgaacctcgaacatt
cagcagcggctggagtacctcggccaccgcgtgcatgatacaggcgatatccacgtgaac
cggctcgatccctgtgcgcccggcgagaagctgaagtatctggccgagatcgcgcgggtg
aatgcggagctggcgcagcgggtggcggcggagatgggccgcgggcacttcccgcttgtc
atcggaggcgaccacagcgtggcgatcggcacgatcaaaggcgtgctgcagcatgtgaac
cggctgggggttatctggttcgacgcccatccggatgtgaacacggaggagacgacgggc
tccgggaacattcacggcatgtccctggcggtcatgctcgggtacgggcacaagagcctg
atctcgatcggcggcgaacaggcgaagatcaacccgcgcaacgtggtcatcattggcgcg
agatcgatcgatccgggcgagcgcatcttcctccgcgagcagggcatccgcgtcttcacg
atgcacgagatcgacaagtacggcatgagggccgtcatggacgaggcgatggagcgggtg
acggacgggacggacggcgttcatctcagcctggatctggacggcatggatccgcaggag
gcgccgggcgtcggcacgccggtcagcggcggcatcacctaccgggagagccactatgcg
atggagacgctgtatgagagcggggcgctcgtctccgcggagatcgtcgaggtgaacccg
atgctcgacatcggcaacaagacggcgcgggcggcggtggagcttgccggatccgtgttc
ggggaacgcatattgtaa

DBGET integrated database retrieval system