KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06343Help
Entry
KNP414_06343      CDS       T01550                                 

Definition
(GenBank) alpha-galactosidase AgaN
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00052  Galactose metabolism
pms00561  Glycerolipid metabolism
pms00600  Sphingolipid metabolism
pms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KNP414_06343
  Lipid metabolism
   00561 Glycerolipid metabolism
    KNP414_06343
   00600 Sphingolipid metabolism
    KNP414_06343
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     KNP414_06343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 GHL10 Peptidase_C54
Motif
Other DBs
NCBI-ProteinID: AEI44864
UniProt: F8FLU8
Position
complement(6998071..7000260)
Genome map
AA seq 729 aa AA seqDB search
MSIRYLEEQRQFHLQAGSSSYILQVYPSGHVVHLYWGAKVRALPMSHVIRTRDRAFSPNP
NPPDRSYSLDALPLEYPGYGNSDFRQPAYQIQLANGTTVTDLKYISHDITAGKPALEGLP
STYVEAEDEADTLKLLLEDALTGLRVELSYTAYRERNVITRSSRIVNGGSESVRMLRALS
ASVDFPHHRFDLLTLPGAWARERYIERRALASGTQSVESRRGASSHQQNPFVALLGKDTT
EERGEAYGFNLVYSGSFLASAEVDQWYTTRVSLGINPFDFSWLLEPGAAFQTPEAVMVYS
AEGLTGMSQTYHELYRTRLCRGEFRDKPRPVLINNWEATYFDFTAEKIEDIAKAGRELGI
ELFVLDDGWFGRRNDDTTSLGDWFVDKAKLPQGLDDLAQRVKGLGLQFGLWFEPEMISVD
SELYRSHPDWCLHVPDRVRSEGRNQLILDLSRPEVCDYIVETVSGVLAGAPISYVKWDMN
RHMTEIGSAALPPERQRETAHRYMLGLYSVMERITTAFPHVLFESCSGGGGRFDPGILHY
MPQTWTSDNTDAVSRLKIQYGTSIVYPVSAMGAHISAVPNHQVHRMTSLKMRGDVAMSGN
FGYELDLTKFTPEEKELAKAQVALYKELRQFVQFGRFYRLISPFEELEAAWMFVSESGDD
VLACYFNVLAEPNEPYKRLKLRGLNPAADYTDLESGEVYGGDELMHAGISLPVQHGDFES
VLIRLRKVQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcgttacctagaggagcagcgtcaatttcatctgcaggccggcagcagcagt
tatattctgcaggtttatccgagcggccatgtggttcacctatattggggggcgaaagtc
cgtgccctgccgatgtctcatgtcatccgcaccagggaccgtgccttctccccgaacccg
aatccgcccgaccgcagctattccctggatgcgctgccgctggagtacccgggctacggc
aattcggacttccgccagccggcttatcagattcagctcgcgaatggaacgacggtcacc
gatttgaaatacatatcgcatgacattacagccggcaagcccgcgctcgaaggacttccc
tccacctatgtggaggcggaggatgaagcggatacgctgaagcttctgctcgaagatgcg
ctgacaggcctgcgtgtcgagctgtcttacaccgcgtaccgagagcgcaatgtcatcacc
cgcagctcccggatcgtcaacgggggatccgaatctgtgcgcatgcttcgcgccttgagt
gccagcgtcgacttcccgcatcaccggttcgatcttcttacgctgccgggtgcgtgggca
agagagcgttatatcgagcggcgggctttggccagcggcacgcagtccgtcgagagccgc
aggggcgcaagctcgcaccagcagaatccgttcgttgcgctgctcggcaaggatacgacg
gaggagcggggcgaggcttacggcttcaaccttgtgtacagcggcagcttcctggcttcg
gccgaggtggaccagtggtatacgacgcgcgtgtccctcggcatcaacccgttcgacttc
agctggctgctggagccaggcgctgcgttccagactccggaggcggtcatggtgtattcg
gccgaagggctgaccggcatgtcgcagacatatcatgagctctaccgtacccggctgtgc
cgcggcgagttccgcgacaagccgagaccggtgctcatcaacaactgggaagcgacgtat
tttgacttcacggcagagaaaattgaagacatcgcgaaggccggacgggagcttggcatc
gagctgttcgtgctcgacgacggctggttcggccggcgcaacgacgatacgacctcgctc
ggcgactggttcgtggacaaggcgaagcttccgcagggactggacgatctggcgcagcgg
gtgaaggggctggggctgcagttcggcctctggttcgaaccggagatgatctcggtggac
agcgagctgtaccgcagccatccggactggtgccttcatgtaccggatcgggtccgctcc
gagggccgcaaccagctcatcctggacctctcccgcccggaggtatgcgactacatcgtt
gagacggtgtccggtgtcctggccggcgccccgatctcctatgtcaaatgggacatgaac
cgccatatgaccgagatcggctccgcggcgctgccgccggagcgccagcgggagacagcg
caccgctatatgctcggcctctattcggtcatggagcggatcacgaccgccttccctcac
gtgctgttcgagagctgctccggcggcggcggccggttcgatccgggcatcctgcattat
atgccgcagacgtggacaagcgacaatacggatgccgtctcgcgccttaagattcagtac
gggacgagcatcgtgtatcccgtctccgcgatgggcgcgcacatctccgcggtgccgaat
caccaggtgcaccggatgacgtccctgaagatgcgcggcgatgtggcgatgagcggcaac
ttcggctacgagctggacctgacgaagttcacgccggaggagaaggagctggcgaaggct
caggttgcgctctacaaggagctgcgccaattcgtgcagttcggccgcttctaccgcctg
atctctccgttcgaggagctcgaggccgcgtggatgttcgtgtcggagagcggggacgac
gtactggcctgctacttcaacgtgctggcggagccgaacgagccttataagcggctgaag
ctgcgggggctcaatccggctgcggactatacggacttggagtcgggcgaggtgtacggc
ggcgacgagctgatgcacgcaggcatttcgctgccggtgcagcatggtgattttgagagt
gtgctcatccgcttgcggaaagtgcagtaa

DBGET integrated database retrieval system