KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06639Help
Entry
KNP414_06639      CDS       T01550                                 

Definition
(GenBank) HAD-superfamily subfamily IIA hydrolase like protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00627  Aminobenzoate degradation
pms01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KNP414_06639
Enzymes [BR:pms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     KNP414_06639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Phage_TAC_6 UPF0180 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AEI45159
UniProt: F8F9W1
Position
7311140..7311940
Genome map
AA seq 266 aa AA seqDB search
MPGFLLDLDGTLYHGDHPIPYAAEFIGWLKERGYPYVYVTNNSSRTPEQVADHLRKTGID
AAAQEVLTSSQAAALYLKDASLPPGPVLYIGEEGLRQALTEAGFEAVPADEAGQLDKAAA
VVQGIDRSFSYGKLLSAVRHIRRGALSVLTNPDHLLPWNGELTPGAGSIGAAIERSSETA
PVVIGKPSPVIMRYAVERLGLPPEEIWAVGDNLGTDIRGGADAGCRTALVLTGLATEENV
SEQIARIGVQPELVCRHLMELAERIG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctttttgctggatttggatggaacgctgtatcacggggatcacccgattcct
tacgctgccgaattcatcggttggctgaaggagcgcgggtacccgtatgtctatgtaacg
aacaattcgtcccggacaccggagcaggtggcggaccacctgaggaagaccggtattgac
gctgcggctcaggaggtgctgacctcctcccaagccgcggcgctgtaccttaaggacgcc
tccctgcctccaggcccggtcctgtatatcggcgaagagggactccgtcaggcgctcacg
gaagccgggttcgaagccgtccccgcggatgaagccggacagctggataaggcggccgct
gtcgttcaggggattgaccggagcttcagctacggcaagctgctgtctgccgtgcgccac
atccgccgcggtgccctgtcggtgctgaccaaccccgatcacctgctgccgtggaacggc
gagctgacgccgggagccggctcgatcggggccgccatcgaacgctccagcgagaccgcg
ccggtggtgatcggcaagccttcaccggtcattatgcgttacgctgtagagcggctcggt
ctgccgccggaagagatctgggcggtgggcgataacctcggcacggacatccgcggcggt
gccgatgcgggctgccgcaccgcgctcgtgctgaccggcctcgcaaccgaggagaacgtc
agcgaacagattgcccgcatcggtgttcagcccgagctcgtatgccggcacctgatggag
ctcgcagagcggatcggttag

DBGET integrated database retrieval system