KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07947Help
Entry
KNP414_07947      CDS       T01550                                 

Gene name
purA
Definition
(GenBank) PurA
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00230  Purine metabolism
pms00250  Alanine, aspartate and glutamate metabolism
pms01100  Metabolic pathways
Module
pms_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KNP414_07947 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KNP414_07947 (purA)
Enzymes [BR:pms01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     KNP414_07947 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AEI46432
UniProt: F8FKR4
Position
complement(8639656..8640939)
Genome map
AA seq 427 aa AA seqDB search
MSTVVVVGTQWGDEGKGKITDFLAESAEVVARYQGGNNAGHTIIINDKKYKLTMIPSGIF
YEDKVCVIGNGMVINPGALLEEIRYIHDNGFTTNNLRISDRAHVIMPYHLVLDGLEEERK
GDNKIGTTRKGIGPCYMDKAARNGIRIADLLDAEEFERKVRHLVAEKNVLIRQVYGSEGL
DADTIIKEYLGYAEQIRPYVTDTSVVLNDLIDDGKKVLFEGAQGVMLDIDQGTYPYVTSS
NPSAGGVCIGSGVGPTKIKQIIGVAKSYTTRVGDGPFPTEQTNETGDWIREKGHEYGTVT
GRPRRVGWFDSVVVRHARRVSGITGLSLNSLDVLAGLETVKICTAYKFRGEVIEHYPASL
KMLAECEAVYEELPGWSEDLSNVRSMEDLPENARKYLERVSELTGIPIAIFSVGRNREQT
NLVAPIY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacggtagtagttgtcggtacccaatggggagacgaaggaaaaggaaagattacc
gattttctggcggaatccgcagaagttgtagctcgttaccagggcggaaacaatgcaggg
cataccatcattatcaacgataaaaagtataaattgacgatgattccatcgggcattttt
tatgaagataaagtttgtgtcatcggcaacggcatggtcatcaatccgggcgcgctgctc
gaggagatccgctacatccatgacaatggcttcacgaccaacaacctgcgcatcagcgac
cgcgctcacgtcatcatgccgtatcatctcgtgctcgacggccttgaagaagagcgcaag
ggcgacaacaagatcggcacgacgcgcaagggcatcggtccatgctacatggacaaggct
gctcgcaacggcatccggatcgccgacctgctggacgcggaagagttcgagcgcaaagtg
cgccacctcgtcgccgagaagaacgtgctgatccgtcaggtatacggctccgagggcctg
gatgccgatacgatcatcaaggaatacctgggctacgccgagcagatccgtccttatgtt
acggatacttccgttgtgctgaacgacctgatcgacgatggcaagaaggtgctcttcgaa
ggcgcacagggcgtcatgctcgacatcgaccaggggacgtacccgtacgttacctcttcg
aacccgtcggccggcggggtctgcatcggctcgggcgtaggcccgacgaagatcaagcag
atcatcggtgtggcgaagtcctacacgacccgcgtaggggatggtccgttccctaccgag
cagacgaacgaaaccggcgactggatccgtgagaagggccacgagtacggtacggtcacc
ggccgtccgcgccgcgtcggctggttcgacagcgtcgtcgtgcgccatgcgcgccgtgtc
agcgggattacgggtttgtccctgaactccctcgacgtgctggccggtctcgagaccgtc
aagatctgcaccgcctacaagttccgcggtgaggtgatcgagcactacccggcatccctg
aagatgctggcagagtgcgaagcggtgtacgaagagcttccaggctggtccgaggacctc
tcgaatgtccgcagcatggaggatctcccggagaatgcccgcaagtatctggagcgtgtc
tccgagctgacagggattccgatcgcgatcttctccgtcggccgcaaccgtgagcagacg
aatctcgtagcgccgatctactaa

DBGET integrated database retrieval system