KEGG   Prochlorococcus marinus MIT 9313: PMT_1488Help
Entry
PMT_1488          CDS       T00143                                 

Definition
(GenBank) putative 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00780  Biotin metabolism
pmt01100  Metabolic pathways
Module
pmt_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PMT_1488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmt01007]
    PMT_1488
Enzymes [BR:pmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     PMT_1488
Amino acid related enzymes [BR:pmt01007]
 Aminotransferase (transaminase)
  Class II
   PMT_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_3 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAE21663
CyanoBase: PMT1488
CYORF: PMT1488
UniProt: Q7V5Q9
Position
1573401..1574543
Genome map
AA seq 380 aa AA seqDB search
MQSQPTSRRRQLRTWRPGPGPAEFKPVSPQGKSKPLLDLASNDYLGLCRHPDLIEAAGAA
LHSEGVGAGGSRLVTGSRPVHVALEEALADWLGRERILLFPSGFQANLAAVIALANRNTP
VLADRLAHHSLLMGVKASGARLQRYGHNDLADLERRLKLCRHHQPHQRPLVVTESLFSME
GTSPPLSTMAELCEVHGARLLVDEAHALGVIGPQGRGLCHGLSAPVSIISGTFGKAFGSG
GAFLAGDCAMGDHLLQTSGAFRYTTALAPPLAAAALTALNLIQSHPQWGKQLQERAEQWR
GQLTARGWARPPGYGPILSLVIGSDQQALNRQSQLEEAGLLSVAIRPPTVPEGTARLRLV
LRRGLPDETLERLMSALETG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagccagcccacatcacgtcgccgccagctgcgcacctggcggccagggccaggg
ccagctgagttcaaaccagtgtcacctcaggggaaatcaaaacctctactagatctggca
agcaacgattacctaggcctatgtcggcatcctgatctgatcgaagccgccggagcggcc
ttgcattcagaaggtgttggagcaggtggatccaggctagtcactggtagccggccagtg
catgttgcactggaagaagcactcgccgactggctaggtcgcgagcggatcttacttttc
ccaagcgggttccaagcaaacctggccgcagtgatcgcactggccaaccgcaatacccca
gtactggctgatcgcctagctcaccattctctattgatgggtgtcaaagcaagtggcgcc
aggctgcagcgttatggccacaatgacctggcagaccttgagcggcgcctcaagctctgc
cggcatcatcaaccgcatcaacggccgcttgtagtcaccgaaagcctattcagcatggag
gggaccagtccaccgctctcaacaatggccgaactctgcgaagtgcatggtgccaggctg
ctcgtggatgaagcccatgccctgggtgtcatcggtcctcaagggcgaggtctttgccat
gggctctctgcaccagtttcaatcatcagcggcactttcgggaaagcattcggtagcggt
ggtgccttcctggctggtgattgcgccatgggcgatcaccttctgcaaaccagtggcgcc
tttcgttacaccacagcactagcaccgcctttagcagcggcagctctcactgccctaaac
ctgatccaatctcaccctcaatggggcaagcaactgcaagagcgtgccgagcaatggcgt
ggtcaattgacagctagaggatgggctcgcccgcctggatatggacccatcctctctctg
gtgatcggttccgaccaacaagctctgaatcgccaaagtcaactcgaggaagccggcctc
cttagcgtggccatccgtcctcccactgttccagaaggcacggcgcgccttcggcttgtg
ctgcgcagggggctacccgatgagacattggaacggctgatgagcgcccttgaaactgga
tga

DBGET integrated database retrieval system