KEGG   Pasteurella multocida subsp. multocida Pm70: PM0075
Entry
PM0075            CDS       T00046                                 

Symbol
pflB
Name
(GenBank) PflB
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00620  Pyruvate metabolism
pmu00640  Propanoate metabolism
pmu00650  Butanoate metabolism
pmu01100  Metabolic pathways
pmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PM0075 (pflB)
   00640 Propanoate metabolism
    PM0075 (pflB)
   00650 Butanoate metabolism
    PM0075 (pflB)
Enzymes [BR:pmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     PM0075 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical Med21
Other DBs
NCBI-ProteinID: AAK02159
UniProt: Q9CPG6
Position
100417..102747
AA seq 776 aa
MSMSQLNETQQKAWEGFTGGDWQTEVNVRDFIQKNYTPYEGDESFLADATEATTKLWNDV
MEKIKVENKTHEPYDIDCDTPSTITSHAPGYIDKSLEKIVGLQTDAPLKRAIMPFGGINM
VKGSCKVYRRELKPEVEQIFTEYRKTHNQGVFDVYTPDILRCRKSGVITGLPDAYGRGRI
IGDYRRMALYGADFLMKDKFNQFTSLQDKLERGEDIQATIQLREEIAEQHRALGKMKEMA
ASYGYDISGPATNAHEAVQWTYFAYLAAVKSQNGAAMSFGRVSTFLDIYIERDLKAGKIT
EQEAQELIDHLVMKLRMVRFLRTPEYDQLFSGDPMWATETLAGMGLDGRTLVTKNSFRIL
HTLYTMGPSPEPNLTILWSEKLPEGFKRYAAKVSIDTSSVQYENDDLMRPDFQNDDYAIA
CCVSPMIVGKMMQFFGARANLAKTLLYAINGGVDEKSGDQVGPKTDPITSEYLDYDDVMT
RLDSFMDWLAKQYVTALNIIHFMHDKYAYEAALMALHDRDVFRTMACGIAGLSVAADSLS
AIKYAKVKPVRGDIEIKNKAGEVVGIAKDVAIDFEIEGEYPQFGNNDNRVDEIACDLVER
FMKKIQKLGTYRNATPTQSVLTITSNVVYGKKTGNTPDGRRSGAPFGPGANPMHGRDQKG
AVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDYEAQKRNLAGLMDGYFHHEATIEGGQ
HLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQAM
NT seq 2331 nt   +upstreamnt  +downstreamnt
ttgagtatgagtcaattaaatgaaactcaacaaaaggcttgggaagggtttaccggtgga
gactggcaaacagaagtgaatgtacgcgattttattcaaaaaaactatacaccttatgaa
ggggatgagtctttcttagccgatgccacagaagccacaacaaaattgtggaatgatgtg
atggaaaaaatcaaagtggaaaataaaacccacgagccgtatgacattgattgcgatacg
ccgtcaacaatcacttcacatgcgccgggttatattgataaaagcttagagaaaattgtt
ggcttgcaaacagatgcacctttaaaacgtgcgattatgccgtttggtggtatcaacatg
gtgaaaggttcttgtaaagtttatcgccgtgaactaaaaccagaagtcgagcaaatcttt
actgaataccgtaaaacccacaaccaaggtgtatttgatgtttatactcccgatatttta
cgttgccgtaaatctggggtaatcacagggcttccggatgcttatggtcgtggtcgtatt
attggtgactatcgtcgtatggctctgtatggtgcagacttcttaatgaaagataaattt
aaccaatttacgtcattacaagacaaactagagcgtggcgaagatatccaagcaacgatt
caattacgtgaagaaattgcggaacaacaccgtgctttaggcaaaatgaaagaaatggcg
gcttcttacggttacgatatttcgggtccagcgactaacgcacatgaagcggtacaatgg
acttactttgcttatcttgctgcagtgaaatcgcaaaacggtgccgccatgtcatttggt
cgtgtatcgactttcttggatatttatattgagcgtgatttaaaagcaggcaaaattaca
gaacaagaagcacaagaattaattgaccacttagtcatgaaattacgtatggtgcgtttc
ttacgtaccccagagtacgatcaattattctcgggcgacccaatgtgggcaacggaaacc
ttagcgggtatgggcttagatggtcgtactttagtaaccaaaaacagcttccgtatctta
cacaccctttatacgatgggaccgtcaccagagccaaacttaacgattctttggtctgaa
aaattaccagaaggtttcaaacgttatgcggcaaaagtgtctatcgatacgtcttctgtt
cagtatgaaaacgatgacttaatgcgtcctgacttccaaaacgatgactatgcgattgca
tgctgcgtgtcgccaatgatcgtgggtaaaatgatgcaattcttcggtgcacgtgcaaac
ttagcgaaaaccttgttatacgcaatcaatggcggtgtggatgagaaatcaggtgaccaa
gtaggaccgaaaaccgatccaattaccagcgaatacttagattatgatgatgtcatgacg
cgcttagacagctttatggattggttagcgaaacaatatgttactgcattgaacatcatt
cactttatgcacgataaatacgcgtatgaagccgcactaatggcgcttcatgatcgtgat
gtattccgtactatggcttgtggtatcgcagggctttctgtcgcagcggactctttatct
gccattaaatatgcgaaagtgaaaccagttcgtggtgatatcgaaatcaaaaataaagcg
ggtgaagtggttggtattgcaaaagatgtggcaatcgactttgaaattgaaggcgaatat
ccacaattcggtaacaacgataaccgtgttgatgaaatcgcttgtgatttagttgaacgc
tttatgaagaaaatccaaaaattgggtacttatcgtaatgcgacaccgacacaatctgta
cttactattacatctaacgtggtttatggtaagaaaacaggtaataccccagatggtcgt
cgttctggtgcaccatttggaccgggtgcgaacccaatgcacggtcgtgaccaaaaaggt
gcggtggcatcgttaacttctgttgcgaaattgccatttgcttatgcgaaagatggtatt
tcttataccttctcaatcgtaccaaatgccttaggtaaagattacgaagcacaaaaacgt
aaccttgcaggtctaatggatggttacttccaccatgaagcaacgattgaaggcggacaa
cacttaaacgtgaacgtcatgaaccgtgaaatgttgttagatgcaatggaaaatccggag
aaatatccacaattaaccattcgtgtttcgggttatgcagtacgctttaactcgttaacc
aaagaacaacaacaagacgtgattacgcgtacctttactcaagcgatgtaa

DBGET integrated database retrieval system