KEGG   Pasteurella multocida subsp. multocida Pm70: PM0152Help
Entry
PM0152            CDS       T00046                                 

Gene name
rbsK
Definition
(GenBank) RbsK
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PM0152 (rbsK)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PM0152 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin BsuBI_PstI_RE DUF498
Motif
Other DBs
NCBI-ProteinID: AAK02236
UniProt: Q9CPA1
Position
complement(179679..180599)
Genome map
AA seq 306 aa AA seqDB search
MKKLTVLGSVNADHVISVPHFAKPGETLTGNHYHIAYGGKGANQAVAAARLGANIDFIAC
IGDDAIGQAMKKAFQQDGINTQAVVEIADQMTGIAMIQVNAHGENSIVIAAGANAYLTET
VVEQFADKITQADTLLMQLETPLRAVIFAAKLAKSANTKVVLNPAPAQPLPDELLTQLDM
ITPNETETEILTGVKVVDEHSAAQAAALFHQKGIETVLITLGSKGVYASQKGTPGKMVAG
FRVDAKDTTAAGDTFNGALMTALLEDKPLADAIRFAHAAAAISVTRAGAQPSIPTRQETL
NFLQSH
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacggtacttggcagtgtaaatgccgatcatgtcatttctgtcccacac
tttgctaaacccggtgaaaccctcacaggcaatcattaccatattgcgtatggaggaaaa
ggtgcaaaccaagctgttgcggctgctcgcttaggtgccaatattgattttattgcttgt
attggtgatgatgcgattggacaagcaatgaaaaaggctttccaacaagatggcattaat
acacaagccgttgtagaaattgccgatcaaatgacaggaatcgccatgattcaagtcaac
gcacacggggaaaacagtattgtcattgccgccggagcaaatgcttatttaacggaaact
gtcgttgaacaatttgcggataaaattacgcaagcggatactttattaatgcaacttgaa
acccctttaagagcggtcattttcgcggcaaaattggctaaatcagccaatactaaagtg
gtgttaaatccggcaccggcccagccacttcccgatgagttactcacgcaattggacatg
attacccctaatgaaacagagactgaaatcttgactggggtgaaggtcgttgacgaacat
tctgctgcgcaagcggcggctctctttcatcaaaaaggcattgaaacggtgctcatcact
ttaggctcaaaaggggtttatgcaagtcagaaaggtacgccgggcaaaatggtcgcaggc
tttcgtgtcgatgcgaaagacacaactgccgcaggtgatacgtttaatggcgctttaatg
actgcattgttagaagataaaccgcttgctgatgccatccgttttgctcatgctgccgca
gcaattagcgtcaccagagcgggcgcacaaccctcaattccgactagacaagaaaccctc
aactttttacaatcacattaa

DBGET integrated database retrieval system