KEGG   Pasteurella multocida subsp. multocida Pm70: PM0226
Entry
PM0226            CDS       T00046                                 

Gene name
secF
Definition
(GenBank) SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu03060  Protein export
pmu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PM0226 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PM0226 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmu02044]
    PM0226 (secF)
Secretion system [BR:pmu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   PM0226 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF543 Sterol-sensing ABC2_membrane
Other DBs
NCBI-ProteinID: AAK02310
UniProt: Q9CP38
Position
complement(252492..253466)
AA seq 324 aa
MVSLFTDKKDAPELSNIKLPYRLIHFMAHRKWGYLLSILVIVASLFFIVTKGFNWGLDFT
GGTVIDMSFSQPAELDKVRLTLEQKGIQGAIVQNSGSVRDIIIRLPAAISDANIGNNIKE
LFAATVDKNVTVHSIEFVGPNVGEELTQSAIYATLATLLMLLVYIGMRFEWRLALGAVAS
LAHDVLVTLGLFSLLQIEMNLTFVAAILTVVGYSLNDSIVVFDRVRENIRKIRRTDVLDI
INISLSQTLSRTLMTSATTIIVVVSLLLFGGPSIHSFSVALLIGIGFGTYSSIFVAIALA
YDLGLKREHMLPPKVDNDALDELP
NT seq 975 nt   +upstreamnt  +downstreamnt
attgtgagtttatttacagataaaaaagatgcgcctgaattgagcaatattaaactaccc
tatcgcttaattcactttatggctcaccgtaaatggggctatctactttcgattttagtc
attgttgcgtcactctttttcatcgtgaccaaaggctttaactggggactcgactttacc
ggtggaacagtcattgacatgagtttttctcagcctgccgaattagataaagttcgcctc
actcttgagcaaaaaggtattcaaggggcgattgtacaaaactcaggtagtgtgcgcgat
attattattcgtttacctgccgcgatcagtgatgccaatattggtaacaatattaaagaa
ctgtttgctgcgacggtagataaaaatgtcacggtacacagtattgagtttgtgggacca
aacgtaggtgaagaattaacccaatctgcaatttatgcgaccttagcgaccttattgatg
ttattagtttatatcggtatgcgctttgaatggcgtctagcattaggggcggttgcttca
ttagcgcatgatgtgttggtaacgcttggactcttttctttactgcaaattgaaatgaac
ctcacctttgtggcagcgattctcactgtggtaggttattcactcaatgacagtattgtc
gtctttgaccgtgtacgagaaaacatccgtaaaattagacgaacagatgttttagatatt
atcaatatatcgctgtcgcaaacgttatcaagaactttaatgacctccgcgacaaccatt
atcgtcgtggtttccttgttattattcggtggaccgagtattcacagtttttccgttgcg
ttattaattgggattggttttggtacctactcctctattttcgtggcaattgcacttgct
tatgacttaggcttgaaacgcgaacatatgttgccaccgaaagtggataacgatgctctt
gatgaactcccttaa

DBGET integrated database retrieval system