KEGG   Pasteurella multocida subsp. multocida Pm70: PM0533Help
Entry
PM0533            CDS       T00046                                 

Gene name
ispA
Definition
(GenBank) IspA
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00900  Terpenoid backbone biosynthesis
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PM0533 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pmu01006]
    PM0533 (ispA)
Enzymes [BR:pmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PM0533 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PM0533 (ispA)
Prenyltransferases [BR:pmu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PM0533 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt Gon7
Motif
Other DBs
NCBI-ProteinID: AAK02617
UniProt: Q9CNA1
Position
complement(610407..611294)
Genome map
AA seq 295 aa AA seqDB search
MYQLSQDLPQLQQRINTFLAQQLNVDSSPSPLAEAMRYGVLLGGKRIRPFLVYATGRMLG
ADLNQLDYAAASVEAVHAYSLIHDDLPAMDDDHLRRGQPTCHIAFDHATAILAGDALQAF
AFEILTQAPALQAEQKLALVQTLSQAAGVKGMCLGQSLDLISEQKHISLIELEQIHRNKT
GAMLSAAIQLGRICSPHFKNDTLAQQLQRYSEAIGLAFQVQDDILDIEGESDIIGKTVGS
DLLADKSTYPKLLGLAGAKQKAQELYQNAIAELESIPFDTSALRAIAEFVVNRKS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaactttcacaagacttaccccaactccaacaacgtattaatacttttttagcg
caacaattgaatgtggacagcagcccctctcctcttgccgaagccatgcgttacggtgtg
ctccttggtggtaaacgtatccgtcctttcctagtgtatgcaacaggacgaatgctcggc
gcagacttaaaccaactcgattatgccgcggcgagtgtagaagccgttcatgcctattca
ttaattcacgacgatctccctgcgatggatgatgatcatttacgtcgtggacaaccaact
tgccatattgcttttgatcacgccaccgcgattttagccggtgacgcgttgcaagccttt
gcttttgaaatattaactcaagcacctgcattgcaagcagagcaaaaacttgcgttggta
caaacgctaagtcaagcagctggtgtaaaaggaatgtgtttggggcaaagtctcgatctg
atttctgagcaaaaacacattagcttaatcgaattagaacaaattcaccgcaataaaacg
ggggcaatgctttccgcagcgattcagcttgggcgaatttgttctccgcattttaaaaat
gatacgctagcacagcaattacaacggtattcggaagccattggcttagcctttcaagta
caagacgatattttagatattgaaggcgagagtgacattattggtaaaaccgtgggttct
gatttattagcagataaaagcacctaccccaaattattaggcttagcgggtgccaaacaa
aaagcgcaagaactgtatcaaaacgcaatcgcggaattagaaagtattccttttgataca
agtgcacttcgtgctatcgctgaatttgtggtaaatagaaaaagttaa

DBGET integrated database retrieval system