KEGG   Pasteurella multocida subsp. multocida Pm70: PM0796Help
Entry
PM0796            CDS       T00046                                 

Definition
(GenBank) unknown
  KO
K03113  translation initiation factor 1
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pmu03012]
    PM0796
Translation factors [BR:pmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    PM0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-ProteinID: AAK02880
UniProt: Q9CMM2
Position
complement(940926..941243)
Genome map
AA seq 105 aa AA seqDB search
MTDTLVYSTETGRIKTEKPQPTRPKGDGIVRIQRQVSGRKGNGVCVITGLDLSDDELKKL
ATELKKRCGCGGAVKDGTIEIQGEKRDLLKDLLEQKGYRVKLAGG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgacagatacattagtctattcgacagaaaccggtcgaattaaaacagaaaaacctcaa
ccaacacgtcctaaaggtgatgggattgtgcgtatccagcgtcaggtgagtggtcgtaaa
gggaatggtgtttgtgtcattactggtttagatttatccgatgatgaattgaaaaaactc
gcgactgaactgaaaaaacgttgtggttgtgggggggcagtaaaagatggcacgattgaa
attcaaggtgaaaaacgcgatcttttaaaagatttactagaacagaaaggctatcgtgtt
aaattagccggtggttaa

DBGET integrated database retrieval system