KEGG   Pasteurella multocida subsp. multocida Pm70: PM1422Help
Entry
PM1422            CDS       T00046                                 

Definition
(GenBank) unknown
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00620  Pyruvate metabolism
pmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PM1422
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmu02000]
    PM1422
Enzymes [BR:pmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PM1422
Transporters [BR:pmu02000]
 Other transporters
  Primary active transporters [TC:3]
   PM1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 Amidohydro_1 Peptidase_M23 RnfC_N DUF2118
Motif
Other DBs
NCBI-ProteinID: AAK03506
UniProt: Q9CL25
Position
1604938..1606746
Genome map
AA seq 602 aa AA seqDB search
MTTQNKKIAITDVVLRDAHQSLFATRMRLDDMLPIAHELDQIGYWSLEAWGGATFDACIR
FLGEDPWVRLRELKQAMPNTPLQMLLRGQNLLGYRHYADDVVDRFVERSVKNGMSVFRVF
DAMNDPRNMKQALQAVKRNGGHAQGTLSYTTSPVHNLETWLEITEQLLEIGVDSVVIKDM
SGILTPVEAYKLVSEIKKRYDVQLHLHCHATTGMAEMALLKAVEAGIDGIDTSISSMSGT
YGHPSTEALVATLQGTQYDTGLDIHKLEHIAAYFREVRKKYAKFEGQLRGSDSRILVAQV
PGGMLTNLESQLKQQNASDKLDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVINVLMGE
RYKTIAKETAGILKGEYGRTPAPVNAELQAKVLDGGQPITDRPADHIAPEMEKLATEIKQ
QAKEKGIKLAENEIDDVLIVALFPQIGWKFLENRGNPDAFEPAPTLETAKPAEKPAAPVA
KTPVSGPAVYTVELEGKSFVVKVTDGGEVGEIAPAAQPTAQTAPQPAPASTSGTPVSAPM
SGNIWKVVAKEGQKVAEGDVLLILEAMKMETEIRASQAGTVQSIHVKAGDTVAVGDTLMT
LS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaaaacaaaaaaattgccattactgatgttgtgttacgtgacgctcatcaa
tctctctttgccacgcgtatgcgccttgatgacatgttgcctattgcacatgagttagat
caaattggctattggtcgcttgaagcctgggggggcgcgacttttgatgcgtgtattcgt
tttttaggggaagatccttgggtacgtttacgtgaattaaaacaagccatgccaaatacg
ccgttacaaatgctgttgcgcggtcaaaacctattaggttatcgtcattatgcggatgac
gtcgtggatcgctttgtagaacgctccgtgaaaaatgggatgtccgttttccgtgtcttc
gatgccatgaacgacccgcgtaatatgaaacaagccttgcaagccgtaaaacgtaacggt
ggacatgcccaagggacattaagttataccactagcccagtacataacttagaaacctgg
ttagagattactgagcaattattagaaatcggtgtcgattccgtggtgattaaagatatg
tccgggattctaaccccagtagaagcctacaaattagtcagtgaaattaaaaaacgctac
gatgttcaactccatttacattgccacgccacgacgggaatggcagaaatggcgctatta
aaagccgtagaagcgggtattgatggcattgacacctccatttcctctatgagtggcact
tatggtcacccgtcaactgaagccttagtcgcgactttacaaggtacacaatatgacacc
ggcttagatatccataaattagaacatattgctgcctacttccgcgaagtacgtaaaaaa
tacgctaaatttgaaggtcaattacgtggttcagatagccgtatcttagttgcacaagta
ccaggtgggatgttgacgaaccttgaaagccagctcaaacaacaaaatgcgtcggataaa
ttagatgaggtattgaaagaaattccacgtgtgcgtgaagatttaggctttattccatta
gttacccctacctcacaaattgtcggtacgcaggccgtgattaacgtgttaatgggtgag
cgttataaaaccattgctaaagaaacagcgggtattttgaaaggtgagtacggtcgtaca
cctgccccggtcaatgctgaattacaagccaaagtgttagacggtggacaacctatcact
gatcgtccagccgatcatattgcaccagaaatggaaaaattagccacagaaatcaaacaa
caagccaaagaaaaaggcattaaactggctgaaaatgaaattgatgatgtattgattgtg
gcgttattcccacaaatcggttggaaattcttggaaaatcgtggcaacccagatgccttt
gaacctgcaccaaccttagaaaccgcaaaaccggcagaaaaaccagctgcacctgtggcg
aaaacaccagtttcaggacctgccgtttacaccgtggaattagagggcaaatcctttgta
gtgaaagtcacagacgggggagaagtcggtgagattgcccctgcagcacaaccaactgca
caaacagcgccacaacctgccccggcatctacgagtggtacacctgtcagcgccccaatg
tctggcaatatctggaaagtggtagcaaaagaagggcaaaaagtggcagaaggggatgtg
ttactcattttagaagccatgaaaatggaaactgaaattcgtgcaagccaagcaggtacc
gtacaaagtattcatgtaaaagccggcgatactgttgccgttggcgataccttaatgaca
ttaagctaa

DBGET integrated database retrieval system