KEGG   Podarcis muralis (common wall lizard): 114581454Help
Entry
114581454         CDS       T06059                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114581454 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pmua03041]
    114581454 (DHX8)
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114581454 (DHX8)
Spliceosome [BR:pmua03041]
 Complex C
  Other components
   Step II factors
    114581454 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 Presenilin ABC_tran HGTP_anticodon2
Motif
Other DBs
NCBI-GeneID: 114581454
NCBI-ProteinID: XP_028557430
Position
13
AA seq 1186 aa AA seqDB search
MAEPVDELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVINLAERNTTFDAFKAALVKNG
AEFTDSLISNLLRLIQTMRPPAKPSTSKEAVKPKTEKEKYKELFPALCRPDNPIVRTMLD
EDDVKVAADALKELEALMPTAERQEKHRSSEDHSKRRRRSRSRSRGRDQKRKRKSPSRSR
TRERNKGKSRYRSRSRSPSWDRKEREKPAEKSNERWRDKHVDRPPPEEPSIGDIYNGKVT
SIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGSKTSL
SMKDVDQDTGEDLNPNRRRNLVGESEEAAMRNPDRPTHLSLVSAPEVEDDTLERKRLTRI
SDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTK
QSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLP
DVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLPIYRLKDQL
IQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEF
GCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHT
DVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPET
DYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYS
ALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQL
VVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKA
MGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLI
MSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKN
NKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRN
AAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLV
EFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcccgtggacgagctcgctaagctcgagtacctgtccctggtctccaaagtc
tgcacggagctcgacaaccacttgggcatcaacgacaaggatctggctgaatttgtgata
aacctcgcagagagaaatacaacctttgatgcattcaaggcagccttggtgaagaatggt
gccgaatttacagattccctcattagcaacctgctgcgtcttatacagacgatgcgaccg
cctgcaaaaccttccactagcaaagaggctgtaaaaccgaaaaccgaaaaggaaaagtac
aaggagttgttcccagccctctgtagaccagacaatcccattgtcaggacaatgttggat
gaagatgatgtgaaggtcgctgccgatgccctcaaggaactggaagctttgatgccaact
gcagaaaggcaggagaagcaccgaagcagtgaggaccacagcaagagaaggcggaggagc
cgcagccgcagcagaggtcgggaccagaagcggaagcggaagtcgccctctcgttcccgg
acgagggagcggaataagggaaagtccaggtaccgttccaggagcagaagccccagctgg
gaccggaaggagcgggagaagcctgcagagaagagcaacgagcgatggcgggataagcac
gtggaccgacccccaccagaggagccttccatcggggacatctacaacggcaaagtcacc
agcatcatgcagtttggctgctttgtccagcttgaaggactcaggaagcgctgggaagga
cttgtccacatctcagagctgcgccgcgaggggcgtgttgctaacgtggccgacgtggtg
agcaaagggcagagggtcaaagtcaaagttctgtccttcactggctctaaaaccagcctc
agcatgaaggatgtagatcaagacacaggggaggatttgaacccaaacagacgtcggaac
ctcgtcggggagtctgaggaggcagccatgagaaacccagaccggccaacccacctgtcc
ttggtcagcgctccagaggtagaggacgatacgttggaacggaagcgcctcacccgcatt
tctgaccctgagaaatgggaaatcaagcagatgattgctgccaacgtgctttccaaggag
gagttccctgactttgacgaggaaacggggatcctgccaaaggttgacgatgaagaagac
gaggacctggaaatcgaactggtagaggaggagccgccgttcctgcgagggcacaccaag
cagagcatggacatgagccccatcaagattgtgaagaaccctgacggctccctgtctcag
gctgccatgatgcagagtgcgcttgcgaaagagaggcgagagctgaagcaagcacagagg
gaggcagagatggactccatccccatgggactcaacaaacactgggtggatcccctccca
gacgtggatgggagacaaatcgctgccaacatgcgagggattggcatgatgccaaacgac
atcccagagtggaagaaacacgccttcggaggcaataaagcctcttacgggaaaaaaact
cagctgtcgatcattgagcagagggaaagtctcccgatttaccggctgaaggatcagctc
attcaggctgttcacgataaccagattctgatcgtcattggggagacaggctccgggaaa
acgacgcagatcacgcagtaccttgctgaggctggctacacctctcgcgggaagattggc
tgcacccagcctcgccgagtggctgccatgtccgtggccaagagggtatcggaggagttc
ggttgctgcctggggcaagaggttggctacaccatccggtttgaggactgtaccagtcct
gagacggtgatcaagtatatgacagacgggatgttgctgcgagagtgcctgatcgacccg
gatctgacgcagtatgccatcatcatgttggatgaagcccacgagcgcaccatacacacc
gatgtgctgtttggtctcctgaaaaagacggttcagaagaggcaagacatgaagttgata
gtgacgtcggccaccttggatgcagttaagttctcccagtacttctacgaggctcccatc
tttaccatcccaggcaggacgtacccggtggagattctctatactaaggagccagagaca
gattacctggatgccagcctgatcacagtcatgcagatccacttgacggagccaccagga
gacatcctggtgtttttgactggccaggaggagatcgacacggcctgcgagatcctctat
gagcgaatgaaatccctgggtcccgacgtccctgagctgatcatcttgcccgtctactcg
gccctgcctagtgagatgcagacacgcatctttgacccagctcccccagggagtcgaaag
gtggtcattgcaacgaacatcgctgaaacttcgctcacaattgacggcatctattatgtg
gtggaccccgggtttgtgaagcagaaagtatacaactcaaagacaggaattgaccagctg
gttgtgacacctatttctcaggcccaagccaagcagcgagctgggagggctgggagaacc
gggccaggcaagtgctaccggctgtacacagagcgggcctaccgcgacgagatgctcacc
accaacgtgcctgagatccagaggaccaacttggccagcactgtgctgtcccttaaggct
atgggaatcaacgacctgctctcctttgatttcatggatgctccgccaatggaaactcta
atcaccgcaatggagcagctgtacactctgggtgccctggatgacgaggggctgctcacc
cgactgggacgccggatggccgagttccccctggagcccatgttgtgcaagatgctcatc
atgtcagtgcatctgggatgcagcgaggaaatgctcaccatcgtctccatgctgtcggtg
cagaacgtcttctaccgacccaaggacaagcaagctcttgctgaccagaagaaagccaag
tttcaccagacggaaggggaccacctcacgcttctggctgtgtacaactcctggaagaac
aacaagttctccaatccctggtgttatgagaacttcatccaagcccgatcgctgcgccgt
gcccaggatattcgcaaacagatgttgggcatcatggataggcacaagttggatgtagtg
tcatgtggaaaagccaccgtacgcgtccagaaagccatttgcagcggtttcttccggaat
gccgccaagaaggatccccaagaaggctaccggaccttgattgaccagcaggtcgtctac
atccacccctcaagtgccctcttcaaccgccagcctgaatgggtggtgtatcatgagttg
gtgctcaccactaaagagtatatgcgggaggtcaccaccattgatccccgctggctggtg
gagttcgcccctgccttcttcaaggtctctgaccccacaaaactcagcaagcagaagaaa
cagcagcgcctggagcccctttacaaccgctacgaagagcccaacgcctggagaatatcg
cgagccttcaggcgccggtga

DBGET integrated database retrieval system