KEGG   Podarcis muralis (common wall lizard): 114582345Help
Entry
114582345         CDS       T06059                                 

Definition
(RefSeq) retinal guanylyl cyclase 2-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua01100  Metabolic pathways
pmua04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114582345
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    114582345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114582345
Enzymes [BR:pmua01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114582345
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   114582345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Ctr
Motif
Other DBs
NCBI-GeneID: 114582345
NCBI-ProteinID: XP_028559125
Position
13
AA seq 560 aa AA seqDB search
MILAWLGFHRFLLRLSNHPRWACCKGPRRQALLFWLLFLSLPCRVLPSTFKVGVMGPWTC
DSIYARAYPDAAAKLAVARINKDPTLNQGYWFDYVLLNEDCKSSQAMVSFVNSERYASGF
VGPVNPATCEAAGLLGRAWNKPVFSWSCLTDDAEVERFGTFSRPLPQASAVLYTVLKYFR
WAHVAVISSGQDLWVEVGQGLAESLRNFGLPVTVVTTMEDEPNGARDALRRVQRAYDVRV
IVMCMHSALLGGEEQRLLLEKAEDLRMTDGTYVFIPYDALTYSMPYQKESYPVLDDSLKL
RMAYDAVLTITIDSPEQSFRQTFREAQEKREIPGHLDADKAHPLFGTIFNSIYFLAKAVE
NTRKSGKWVMGSTIAEHAKDFELEGFSQPVSADEYGDAVLPYIILDTNGKGNRLWPTYSV
NVGARTLRYVGHTIHWPHSSSPDTDSICWFDSVTICSGGVNAGFILLIFLLAICLMVGGA
ALAFHLRRQFQHAQLMKGPDKIVLTMDDLTFIHTQNSKKKMDDSRKSMSDMKSLKSVAAN
AENSNMAVVEVKACPLLHSS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatcctagcctggcttggcttccacagattcctgctccgcctttccaaccaccccagg
tgggcctgctgcaagggcccccgccggcaagccctcctcttctggctcttgttcctctct
ttgccctgccgcgtcctgccatcaaccttcaaggtgggcgtgatgggcccttggacctgc
gactccatctacgccagggcctaccctgacgcagcggccaagctggccgttgcccgcatc
aacaaggaccctactctgaaccagggctactggtttgactatgtcctcctcaacgaagac
tgcaagtcgtctcaggccatggttagctttgtcaactcggagcgctatgcctctggcttc
gtgggcccggtcaacccagccacctgtgaggcagctgggctgttgggcagagcttggaac
aagcccgtcttctcctggtcttgcttgactgacgatgccgaggtggaacgtttcggcacc
ttttcccggccgctgccccaggcctccgccgtcctctacaccgtgctcaagtacttccgc
tgggcccacgttgctgtgatcagctctggccaggacctctgggtggaagtagggcaaggc
ctggcggagtcattgcgcaactttggcctccctgtcactgtcgtgaccaccatggaggac
gaaccgaatggggcacgggatgccctccgccgggtacagagggcctatgatgtacgagtg
atcgtcatgtgtatgcactctgccctgctgggtggggaggaacagcggctcctgctggag
aaggcagaggacctgcgtatgacagacgggacctacgttttcatcccctacgacgccctg
acttacagcatgccctaccagaaggagtcctaccctgtgctggatgacagcctcaaactc
cgcatggcctacgacgcggtgctcaccatcaccatcgactccccggagcagtccttccgg
cagactttcagggaggctcaggagaagagggaaatccctggccacttggatgctgacaag
gcacaccccctgtttggtactatctttaactccatctacttcctggccaaggcagtggag
aatactcggaagtccggcaagtgggtgatgggctccaccattgcagagcatgccaaagac
tttgagctggaaggcttcagccagccagtgtcagccgacgaatacggagatgccgtgctc
ccctatatcatactggacacaaatgggaagggcaaccgcctctggcccacctacagtgtg
aacgtcggtgctcgaactctgcgctacgttgggcacacaatccattggcctcacagttcc
agtccagacacggactccatctgctggtttgactcggtcaccatctgcagtgggggggtg
aatgctggttttatcctcctcatattcctcctggctatctgcttgatggtgggtggagcc
gcccttgctttccatctcaggcggcagtttcagcatgcccagctaatgaaggggcctgac
aagattgtcctcaccatggatgacttgaccttcatccatacccagaacagcaagaagaaa
atggacgacagtcgaaagagtatgtcggacatgaaaagcctcaagagtgtggcggcaaac
gcagaaaacagcaacatggctgtggttgaggtaaaagcatgtcccctccttcacagttcc
tag

DBGET integrated database retrieval system