KEGG   Podarcis muralis (common wall lizard): 114582346Help
Entry
114582346         CDS       T06059                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00564  Glycerophospholipid metabolism
pmua00565  Ether lipid metabolism
pmua00590  Arachidonic acid metabolism
pmua00591  Linoleic acid metabolism
pmua00592  alpha-Linolenic acid metabolism
pmua01100  Metabolic pathways
pmua04010  MAPK signaling pathway
pmua04217  Necroptosis
pmua04270  Vascular smooth muscle contraction
pmua04370  VEGF signaling pathway
pmua04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    114582346
   00565 Ether lipid metabolism
    114582346
   00590 Arachidonic acid metabolism
    114582346
   00591 Linoleic acid metabolism
    114582346
   00592 alpha-Linolenic acid metabolism
    114582346
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114582346
   04370 VEGF signaling pathway
    114582346
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114582346
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114582346
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114582346
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     114582346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B F-box_5
Motif
Other DBs
NCBI-GeneID: 114582346
NCBI-ProteinID: XP_028559127
Position
13
AA seq 567 aa AA seqDB search
MASNATGKGEVKVRISKALSEGEKAATAARKEEVKKGLGKLGIPCNEDQIPNIAVLGSGG
AVRAMIALYGTLAELKKYNLLDCVMYLGGVSGSTWCISALYKHEDWAEKIEALEKSQCET
LVKGQWEFQKAMKAVIGAAEDECYSLTDFWSYFLVHKLLNELDESELPVHRGACENGKNP
YPIYNAVDKETYEQQHAGTWFEFTPHEAGVPGLGAYVDMKHFGSIFENGQLTEEKKKRDI
CYLQGLWGSALGSEQELYRTIIDSLLNYLKQKRSGDSSSTSTNLDQDDQKLKTLYEGYQS
ILELHLCETSDGRTADKHFDHLRNILKNHSSSRSYELLREICKTWFSANAETRKKDCMRL
CQALDLDFGGFSSDSLRVLHDVVRKTYLCLLNWTWGSTNNFLYHCLDVECPDLTSKQVVS
LIDAGLAINAAYPSLLQSERKVKLILSFDFSAGDPFLTIKKAIKYCEEHGIPFPKIDERE
LQDTDDLKDCYIFRGDAECVPTVVHCPLFNKVNCSDKIHEYREQFSTFKMSYSKEEIEKL
LTAAKQNVANVHEKILEEIKNVVGPPS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaatgcaactgggaagggagaagttaaggtccgtatttctaaagcactctca
gagggtgaaaaagcagctacagctgccaggaaggaagaggtgaagaaaggccttggcaag
cttgggattccgtgtaatgaggaccaaatcccaaatattgctgtcctgggatcaggtgga
gctgtgcgggccatgattgctctctatgggacactagcggagctgaagaaatacaacctc
ttggactgtgtgatgtacttgggcggggtgtcaggttctacctggtgcatttcagctctc
tacaaacatgaagactgggcagaaaaaatagaagccttagaaaaaagtcagtgtgaaacc
cttgtcaaaggccagtgggaatttcagaaggcaatgaaagctgtgattggggctgcggaa
gatgaatgttactctttgactgatttctggtcctatttccttgtgcataaactgctaaac
gagcttgatgagtctgaactacctgtgcacaggggagcttgtgagaatgggaaaaatcct
tacccgatctataatgctgtggacaaggaaacctatgagcaacaacatgcaggcacctgg
ttcgaattcaccccacacgaagctggggttcctggcctgggagcatatgtagacatgaag
cattttgggagcatatttgaaaatgggcaactgactgaagaaaagaagaaaagagatatc
tgctatttgcaaggtttatggggaagtgcccttggaagcgaacaagagctctataggact
ataatagattctttgctgaattatctaaaacaaaagagatcaggagactcttcctcaact
tcaacaaacttagatcaagatgaccagaaacttaagacactctatgagggttatcagtcc
attctagagcttcacctctgtgaaacatcagatggaaggacagcagataagcattttgac
cacctccgcaacattttgaaaaaccatagttccagcagaagctatgaattgcttagagag
atctgcaagacctggttttctgctaatgcggaaacaagaaagaaagactgtatgagactg
tgtcaagcactggacctggattttggaggtttttccagtgattccctccgtgttttacat
gatgtggtgagaaagacgtatttatgccttttgaactggacatggggaagcactaataac
ttcctgtaccactgcttggatgttgaatgtcctgacttgacaagcaaacaggttgtctct
ctgattgatgctggcctggcgataaacgctgcttacccatcccttcttcagtctgagagg
aaagtgaagttgatcctctcctttgacttcagtgccggagatccttttctgaccattaag
aaagccattaaatactgtgaggaacatggaatcccatttcccaagatcgatgagagagag
ctgcaggacacggatgatttgaaggattgctatatcttcagaggagatgcagaatgtgtc
ccaactgtcgtgcactgtccactgttcaacaaagtcaactgttcagataaaatccatgaa
tacagagaacagttttctacattcaagatgagctattcaaaggaggagattgaaaagttg
ctcactgcagcaaagcaaaatgtagcaaatgttcacgaaaagatcttggaggagatcaag
aatgttgtaggtcctccttcataa

DBGET integrated database retrieval system