KEGG   Podarcis muralis (common wall lizard): 114582657
Entry
114582657         CDS       T06059                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmua03000]
    114582657 (AHRR)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    114582657 (AHRR)
SSDB
Motif
Pfam: PAS PAS_3 HLH PAS_9 PAS_11 PAS_4
Other DBs
NCBI-GeneID: 114582657
NCBI-ProteinID: XP_028559678
Position
13
AA seq 725 aa
MIPPGECLYAGRKRRKPIQKQRPLHGNGKSNPSKRHRDRLNAELDHLASLLPFPPDIIAK
LDKLSVLRLSVSYLRVKSFFQAVQEKCLKKHAGHEIKEVGMLKEPAIPEGRFLLESLSGF
VLVVSADGMIFYASPTIVDYLGFHQTDVMHQNIYDYVHVDDRQDFCKQLHWAMNPPQLIS
GQHMPTETGEEFILNEMFKAQEGNSTPSDFSSFLTRCFTCRIRCLLDSTTGFRAMHFQGK
LKFLFGQKKKSPSGAILHPQLSLFCIVVPLLLPSVADMKLKSLFVKSKCRSDQAATTDAN
SKAISEQYMTDLHRRNAFQEGKNNREQGISLKRLQANEDHWVWIQASTQVQYRNGSSEYA
IALQQAPEEDCHQKIASSTTNTKRNRENLVQMKYSKWAPRKKEQDSIKVKFEPCTDDEEC
FIQQELVGPTASLFGTQYSNSRNGISTSVNPSNYCSRSQRNETTCSSKTPRPFYNRDQRL
FSLSSACPSPWAGTENCQPHPSLQQCTTQSYSGEYMKLQCPLVSSETPYNTGLAHNIKTE
YDSDSENIGAVSASRVWIGENSTRKKQAIRFPTRVHLKTELDLSEHLSPCQTPKQCVYPP
YNWQHIVMHHPNLSRSGPGRGVQSKEIVPLSSQNSVCAEAMEAAQDTHYWNEFYNPSLVE
EKGLNRQVLKMQCEFKNPSFIQTVKHEPLESSRMSGRVQTTFPESTLAGSQPHKIMGCAF
SQQMV
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgattcctccaggagaatgcctgtatgctgggaggaaaagacggaaacccatccagaaa
cagaggcccctgcatgggaatgggaagtctaatccttcaaagagacacagagatcgcttg
aatgctgagttagatcacctggccagtctcctgcctttcccaccggacataatagctaaa
ctggacaaactctccgtcttgcgtctcagcgtcagttaccttagagtcaaaagcttcttt
caagctgttcaggagaagtgtttgaaaaagcacgcaggtcatgaaataaaggaagttggc
atgctcaaggagcctgccataccagaaggcagattcttactggagtcactgagtggtttt
gttctggtggtgagtgctgatggaatgatattctatgcatcaccaacgattgtggattat
ctaggatttcaccagactgatgtaatgcatcaaaatatatatgattacgttcatgtggat
gaccggcaggatttctgcaaacagctacactgggccatgaatccgccacaactcatttct
ggacaacatatgccaacggagacaggagaagaattcatccttaatgaaatgtttaaagca
caggagggtaacagtacgccatcagacttttcatcctttttaactcggtgcttcacttgt
cgaattcgctgtcttttagacagtactactggcttccgtgcaatgcactttcaaggcaaa
ctgaaatttctctttgggcagaaaaagaagtcaccctcaggagcaatattacaccctcag
ctgtccttattctgcatagtggtgccacttctgcttccttctgtggctgacatgaagcta
aaaagcctttttgtgaaatcaaaatgcagatctgatcaagcagccacaacagatgcaaac
tcaaaggctatttctgaacagtatatgactgatcttcatagaaggaatgctttccaagaa
ggaaagaataatagagaacaaggcatttctctgaagagactgcaagcaaacgaagaccat
tgggtttggatacaggccagtactcaagttcaataccgaaatggttcttcagaatacgcc
attgctctacagcaagctcccgaggaagactgtcatcagaagatagcaagcagcaccaca
aacacaaaaaggaacagggaaaaccttgtacagatgaagtatagtaaatgggccccaagg
aaaaaagagcaggacagcataaaagtcaagtttgaaccttgtacagatgatgaagaatgt
tttattcagcaagaacttgtcggtcctactgcatcactattcggtactcaatacagtaac
agcagaaatggcatttcgacttcagtgaatccatcaaattactgttctagaagtcagcgt
aatgagactacatgttcaagcaaaactcctagacctttctacaatagagaccaacggctc
tttagtttatcatcagcatgtccttctccctgggctggcacagaaaattgccagcctcat
ccaagcttgcagcagtgcacaacacaaagttattctggagaatacatgaagttgcaatgt
ccattagtatcctcagaaactccgtacaacacggggctggctcataacatcaaaactgaa
tatgattcagattctgaaaatataggtgctgtttcagcaagtcgggtctggattggtgaa
aacagcacaaggaaaaagcaagcgatccgttttcctacgagggttcacctcaaaacagaa
ctggacctcagtgagcatctgtctccttgccaaaccccaaagcagtgtgtttatccgccg
tataactggcaacacattgtgatgcaccatcccaacctcagcagaagtggacctggcaga
ggagtgcaaagcaaggagatagttcctctgagctcccaaaactcagtctgcgcagaagca
atggaggctgcacaagacacacattactggaatgaattttataatcccagtttagtagaa
gagaaggggctgaataggcaagttctgaagatgcagtgcgaatttaaaaaccccagcttt
attcagacagtcaaacacgagcccttagaatcttctcgcatgtctggcagagtacaaact
acttttcctgaaagcacattagccggctctcaacctcataaaataatgggatgtgcattt
tcacaacaaatggtatag

DBGET integrated database retrieval system