KEGG   Podarcis muralis (common wall lizard): 114582726Help
Entry
114582726         CDS       T06059                                 

Definition
(RefSeq) autophagy-related protein 16-like isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04136  Autophagy - other
pmua04140  Autophagy - animal
pmua04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114582726
   04136 Autophagy - other
    114582726
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114582726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114582726
   03029 Mitochondrial biogenesis [BR:pmua03029]
    114582726
Membrane trafficking [BR:pmua04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    114582726
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    114582726
Mitochondrial biogenesis [BR:pmua03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114582726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16
Motif
Other DBs
NCBI-GeneID: 114582726
NCBI-ProteinID: XP_028559801
Position
13
AA seq 365 aa AA seqDB search
MPGAGWRQHVRAELERRERRARGLRLLLERHEKLYGRLDALQTLLAAAEEEEGQWPVPVG
SCRRPQEVASVRVQQEMELIELRREREELCQRVALLTDILREAEAENKEQRAKMRCLAQD
LAALTRRHEEAQCQAWALSQEAEGLRRELAETQGLMQEAQRKREELEARWVREKALEAGR
LNQANEQHDRYQRRVRRLQEKLQEAREAAGMKGGHPTACPQHGLPLSLDAGFPGRQLQNR
PPATAPSARLARKPAQKGGAAQRFQKKHQQSPAPLGPHPLWVSAQLQVQFSRQPPPRECS
LALSKNTCTAGGGLAQWSQHACNGTLVLDLDLVSRRVCWLCELLRKRGLSHTHNPGVYKF
FGGQG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgcgggctggcggcagcacgtgcgcgcggagctggagcggcgggagcggcgc
gcgcggggcctgcggctgctgctggagcgacatgaaaagctgtatggccgcctggatgct
ctgcagaccctgctggcagcggcggaggaggaggaggggcagtggccagtgccagtgggg
tcctgccggcgcccccaggaagtggcctccgtccgggtgcagcaggagatggagctgatt
gaactccggagagagagagaggagttgtgccagcgtgtcgctctcttgacggacatcctg
agggaggcggaggcagagaacaaggagcagcgggcaaagatgaggtgcctggcccaggat
ctggctgccctgacccgccggcacgaggaggcgcagtgccaggcctgggcgctttcccag
gaggccgaggggctgcgccgggagctggccgagacgcagggactcatgcaggaggcgcag
cggaagagggaggagctggaggcgcgctgggtgcgcgagaaggcgctggaggctggccgg
ctgaaccaggccaacgagcagcacgaccggtatcagcgcagagtccggcgcctccaagag
aagctgcaggaggccagggaagcggccggcatgaaaggggggcaccccactgcctgcccc
caacacggtctgcccctctctctcgacgcaggattcccaggccggcagctgcagaatcgt
cccccagcgacagcaccttcagcacgtcttgcgaggaaaccagcgcagaaggggggagca
gcccaaaggtttcagaagaagcaccagcagagcccagcccccctcgggcctcatcccctc
tgggtcagcgcgcagctgcaggtccaattctcgaggcagcccccgccccgtgaatgcagc
ctggccctttccaagaacacctgcacagccggtggtgggcttgctcagtggtcacagcac
gcttgcaatggcaccctggttcttgacctggacctcgtgtcacggagagtgtgctggttg
tgtgaattgctcaggaaaagggggctaagccacacccacaaccctggagtctacaagttt
tttggggggcagggatag

DBGET integrated database retrieval system