KEGG   Podarcis muralis (common wall lizard): 114583621Help
Entry
114583621         CDS       T06059                                 

Definition
(RefSeq) retinal guanylyl cyclase 1-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua01100  Metabolic pathways
pmua04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114583621
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    114583621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114583621
Enzymes [BR:pmua01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114583621
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   114583621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 114583621
NCBI-ProteinID: XP_028560742
Position
13
AA seq 257 aa AA seqDB search
MLFSYRQKTGVIAARHRKDPKTGAPVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLL
NDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGNRHAGEIANMSLDILSAVGTFKM
RHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNIRTV
QILHDLKEGYKLDLRGKTELKGKGTEETFWLTGRAGFNKPIPTPPDLQPGASNHGISMHE
IPEDRRKKLEKARGGNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcagctaccgccagaaaactggagtcatcgctgcacgacaccggaaggatccg
aagactggtgctccagtggaaccagagtattttgaagaggtgaccttgtacttcagtgac
attgtgggcttcaccaccatctcagccatgagtgagcccattgaggtggtcgaccttctg
aatgacctgtacaccctcttcgatgccatcatcggctcccatgatgtctataaggtggag
accattggcgatgcctacatggttgcttccgggctgcccaagcgcaacggcaaccggcac
gcaggtgagatcgccaacatgtcgctggatatcctcagcgctgtcggcaccttcaagatg
cgtcacatgccagaagtgccagtacggatccgcatcggcctgcactcagggccttgcgtg
gctggtgtggtggggctgacgatgccacggtactgtctttttggagacacagtcaacacc
gcctcacggatggagtccacaggactgccttatcgaatccacgtcaacatccgcactgtt
cagatcctacatgacctcaaggagggctacaagctggatctccgaggcaagacggagctc
aagggaaaaggcactgaagagacattttggctcacaggccgggcgggcttcaacaaacct
atccccaccccccctgacctacagccaggggccagcaaccacgggataagcatgcacgag
atcccagaagaccgaaggaagaagctagagaaagcacgcggagggaatgcgtag

DBGET integrated database retrieval system