KEGG   Podarcis muralis (common wall lizard): 114586536
Entry
114586536         CDS       T06059                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00100  Steroid biosynthesis
pmua01100  Metabolic pathways
Module
pmua_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    114586536 (TM7SF2)
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     114586536 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT Oxidored_q2
Other DBs
NCBI-GeneID: 114586536
NCBI-ProteinID: XP_028565972
Position
16
AA seq 420 aa
MRAGRWPGQVSASRIQAPPGAALLIVLMPTTVFYLLLTCRTEQASLLNIPYPLPTLRSLW
DPRDFALVLAWVGLQAFLYMLPMGKLTEGTPLRDKTRLQYRINGCHAMVVTALVVGAGLA
AGLRLSYIHDHFLQLAFSASLVAFGLSALLYLKALLAPEAALAPGGNSGNPIYDFFMGHE
LNPRINTFDLKFFCELRPGLLGWALINMAMLVKETELRGSPSLAMILVNGFQLLYVVDAL
WHEEAVLTTMDIVHDGFGFMLAFGDLTWVPFLYTLQSYFLVTHPQKLSLPMAGGITLLNG
LGYSIFRGANSQKNAFRRNPADPKVAGLRTIPTATGRRLLVSGWWGFVRHPNYLGDLIMA
FAWSLPCGLTHILPYFYVLYFTMLLIHREARDEHQCLRKYGLAWQEYCRRVPYRIFPYLY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgcgggcgggcaggtggccgggacaggtgagcgcctcccgcatccaggcgcctccaggg
gctgccctccttatcgtcctgatgcccaccactgtcttctacctcctgttgacttgcaga
acggagcaggccagcctgttgaacatcccctatcctttgcccaccctccgctccctgtgg
gacccccgggactttgccctagtcttggcctgggttggattgcaagctttcttatatatg
ctcccgatggggaagctcacagaagggacccccctgcgagacaagacccggctccagtac
cggattaatgggtgccatgccatggtggtcacagcgctggtggttggagccggcctggcg
gctggactgcgcctcagctacatccacgaccatttcctgcagttggccttctctgcctcc
ctcgtggccttcggactcagcgccctcctgtacctcaaggccttgcttgccccagaggca
gccctggccccaggcgggaactcaggaaaccccatttacgacttcttcatgggccacgaa
ttgaacccacggatcaatacctttgacctgaagttcttctgtgagctgcgcccgggtctc
cttggatgggccctgattaacatggccatgttggtgaaggagacggagctgagaggaagc
ccttccttggcgatgatccttgttaatggcttccagcttctctacgtggtggatgcctta
tggcacgaggaggctgttctcaccacgatggacatcgtccatgacggtttcggcttcatg
ttggctttcggggacttgacgtgggtgccctttttgtacaccctccagtcatatttcctc
gtcacccacccgcagaagctgagcctgcccatggctgggggcatcaccctgctaaacggc
ctgggctactccattttccgtggtgccaactcccagaagaatgcctttcgccggaatcct
gctgaccccaaagttgctggactgcgaaccatccccacggccacaggacggcgcctgctg
gtgtccggctggtgggggtttgtgcggcaccccaactacttaggagacctcatcatggct
tttgcgtggtccttgccctgcggcctgacccacatcctgccttacttctatgtcctctac
ttcaccatgcttctgattcaccgggaagcccgggacgagcaccagtgcctgaggaagtat
ggcctcgcctggcaggagtattgccgccgtgtcccttaccggatcttcccctacctctac
tga

DBGET integrated database retrieval system