KEGG   Podarcis muralis (common wall lizard): 114587482
Entry
114587482         CDS       T06059                                 

Gene name
RDH5
Definition
(RefSeq) LOW QUALITY PROTEIN: retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    114587482 (RDH5)
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     114587482 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 114587482
NCBI-ProteinID: XP_028567625
Position
2
AA seq 320 aa
MLCCYALLFSILWIVVWFLRDRQTLSSYKDKYVFITGCDTGFGNMLAKRLDKKGFQVLAG
CLTQKGADNLQRSSSPNLRTILLDVTNSESISKAVQWVKGEVGEKGLFGLVNNAGVANPI
GPTEWMGVEDYRKVMSVNTFGVIEVSLAFLPLLKRARGRVVNTSSVLGRLSANGGGYCVS
KYTVEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLESIEASLRLLWDRLSPETRQSYG
EDFFPNYLKVQKFIMNIICDPDLSKVTNCMEHALQAKYPRTRYSAGWDAKFVWLPVSYLP
AFMVDIVLATILPKPAHRAH
NT seq 963 nt   +upstreamnt  +downstreamnt
atgttgtgttgctatgcgctgctcttcagtatcctctggattgtggtgtggttcttgcgc
gaccggcagacattgagctcctacaaggacaagtatgtcttcatcacaggctgcgacacg
ggtttcgggaacatgctggccaagcgcctggacaagaagggctttcaggtgctggcaggt
tgcctaacccagaagggggctgataacctgcagcggtccagctcgccaaacctgcgcacc
atcctgctggacgtcaccaactccgagagcatctctaaagccgtgcagtgggtgaaaggt
gaagtgggagagaaagggctctttggcttggtgaacaatgcaggtgtggccaaccccatt
ggccccacagaatggatgggcgtggaggattaccgcaaggtcatgtctgtcaacaccttt
ggggtcatcgaggtatctctggccttcctacctttgctcaaacgggcacgtggccgagtg
gtcaacacctccagcgtcttgggtcgcctctcagccaatggcggtggctactgtgtttcc
aaatacactgttgaggccttctccgacagcctcaggagggatatgtaccattttggggta
aaggtctctattgtggagccgggcttcttcaagacggctgtgaccaaccttgaatcaata
gaagcctccttaagactactctgggaccgactgagccccgagactcggcagagctatggt
gaagacttctttccaaactacctgaaagtccagaagttcatcatgaacatcatctgcgac
ccagacctcagcaaagtgaccaactgcatggagcatgcccttcaggccaaatacccccgc
acccgctatagcgctggctgggatgccaagtttgtgtggctgccagtctcttatctacct
gccttcatggtggacattgttttggctaccatcctacccaagccagcccatcgggcccac
tag

DBGET integrated database retrieval system