KEGG   Podarcis muralis (common wall lizard): 114588940Help
Entry
114588940         CDS       T06059                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00450  Selenocompound metabolism
pmua00970  Aminoacyl-tRNA biosynthesis
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    114588940 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    114588940 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmua01007]
    114588940 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmua03016]
    114588940 (MARS2)
Enzymes [BR:pmua01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     114588940 (MARS2)
Amino acid related enzymes [BR:pmua01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   114588940 (MARS2)
Transfer RNA biogenesis [BR:pmua03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    114588940 (MARS2)
 Prokaryotic type
   Other AARSs
    114588940 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 114588940
NCBI-ProteinID: XP_028570586
Position
Z
AA seq 575 aa AA seqDB search
MLLLLLRSLAARRLLRAAVLPGQGSRRGCHASDRSGRPLLLTTPIFYANGPPHIGHLYSA
LLADALHRHRELQGRGRGRFTTGTDEHGLKIQMTAAAAGSSPEPFCDCMSAKFQELFNQA
GISYTDFIRTTEPRHKRAVEHFWAALQDQGWLYQAHYEGWYCTAEETFLAASQVTERPDA
HGNRHMVSLESGHQVHWTKEENFMFKLSEFREPLLRWLQESKAAITPEPFHQQVLHWLEQ
DLPDLSVSRDRKRLQWGIPVPHDSTQTIYVWVDALVNYLTVVGYPDTHHTWWPSATHIVG
KDILKFHAIYWPALLMAVGLEPPEKILVHSHWTVQGQKMSKTLGNVVDPQACFQRYSVDG
FRYFLLRQGVPERDCDYYDEKAVNLVNSELADALGGLLNRCTAPSLNPSGCYPGFSEACF
PRVMDAHNRRGKALAEDYKLVSSVKHLPAHVSDCFERFQIYKALESILDCVRQTNGFLQR
HAPWKLRREDPEEQQWQDTILHITLECLRIYGSLLQPMIPNTADKILTRLGVSPTERSLS
NLNFLPRYYGERSPFEGRRLGADAGLLFPKLEKSK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctccgctccctcgccgcgcgccgcctgctccgcgctgctgtcctc
cccgggcagggttcgcggagaggctgccacgcctcggaccggagcggccggccgctgctg
ctcaccacgcccatcttctacgcgaacggcccgccgcacatcgggcacctgtactctgcg
ctgctggctgatgcgctgcaccggcaccgggagctgcagggccgcggaagagggcgcttt
accacgggaactgatgaacatggtctgaagatccagatgacagcagcggctgcaggcagt
tcccctgaaccgttctgtgactgtatgtcagctaaattccaagaactcttcaaccaggca
ggcatctcttatacagacttcatccgtaccacagaacctcggcacaaacgggctgtagag
cacttctgggctgctctgcaggaccagggctggctctaccaggcccactatgaaggctgg
tactgtactgctgaagaaaccttcttggctgcttcccaggtcactgagcgtcctgatgct
catggcaacaggcacatggtctcacttgagagtggccaccaggtgcactggaccaaagag
gagaacttcatgttcaaactgtccgaattccgggaacctttgctgagatggctccaggaa
agcaaggcagccataacccctgagcctttccaccagcaggtgctccattggctggagcag
gacttgcctgacctctctgtgtcgcgtgaccgaaagcggctgcagtggggcatccctgtc
ccccacgactcgacgcagaccatttacgtctgggtcgatgccctggtgaactacctgacc
gttgtgggttatcctgacacacaccacacctggtggcccagtgcaacccacattgtgggc
aaagatatcctcaagttccatgccatctactggcctgccctcctcatggcagtggggctg
gagcctccagagaaaatcctggtgcactcccactggacagttcaagggcagaagatgtca
aaaactctgggcaatgtggtagaccctcaggcctgtttccagcggtactcagtggatggc
tttcggtacttcctgctgagacagggtgtccctgagcgagactgcgactactatgatgag
aaggctgtcaacttggtcaattcagagttggctgatgccttggggggtcttcttaaccgg
tgcacggcccccagcctcaaccccagtggatgctacccaggcttttcagaggcatgtttc
cctcgggtcatggatgctcataatagaagaggcaaagccttggctgaggactacaaactg
gtgtcatcagtgaaacacctgcctgctcatgtgagcgactgctttgaacgctttcagatc
tacaaagctttagaatcgatcctggactgcgtgaggcagacgaatggcttccttcagagg
cacgcgccttggaaactacgtcgtgaagatcctgaggaacagcagtggcaagataccatc
ctgcacatcactctggaatgccttcggatttatgggagcctcctgcaaccaatgatccca
aacactgctgataaaatcctcaccaggctgggtgttagtcccacggaaaggtctctaagc
aacttgaactttcttcctcgctactatggcgaaaggtctccctttgaaggcaggaggctt
ggggcagatgctgggctcctatttccaaagctggagaaatccaaatga

DBGET integrated database retrieval system