KEGG   Podarcis muralis (common wall lizard): 114589118
Entry
114589118         CDS       T06059                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmua01002]
    114589118 (ADAMTS13)
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     114589118 (ADAMTS13)
Peptidases and inhibitors [BR:pmua01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   114589118 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS Reprolysin ADAM_CR_2 TSP_1 TSP1_spondin Reprolysin_4 Reprolysin_3 ADAM_spacer1 Reprolysin_5 TSP1_CCN Reprolysin_2
Other DBs
NCBI-GeneID: 114589118
NCBI-ProteinID: XP_028571035
Position
Z
AA seq 1600 aa
MTLNTWVVFCAVFPLGVCWLSRTQWTFLDSLETHDTSSYFGTNSVFEVPEFKVVYLTCSC
EEGHAGRTSCKTQLCSFRASGEVFAFKFPDDQALFSTSFVSNRRLSSSNSLLRRFWGNCF
AGGQVLSPPGAEGRMTYCEGQLQGFVIVHGAKIHIKPVRRQDQGLLMGPLLPKPHIILRT
QQNNKTTQTGRRFPSRYRRGAEGDVKHLELLVVVGPDVFHFHKEDTERYILTNVNIGAEL
LRDASLGAQFRVHLVQMIVLTEPEEGINISTNITSSIISICKWAGKVNPENDSDPHHADL
VLYVTRFDLELPDGNKQVRGVTQLGGACSSSWSCIITEDTGFGLGVTIAHEIGHSFGIQH
DGEGNRCAGDGHIMGSEGGHNSVDLTWSACSREQFLAFVSTGQASCTNDLPDLKDNIPGG
KPGLYYGVDEQCKTAFGGGATACTFSRHDIDMCKVLSCHTNPADQSSCTRILIPLLDGTE
CGINKWCSKGRCRSLEELIPIAAVHGKWSTWTAFTACSRSCGGGVVARRRQCNNPRPAFG
GRQCEGADLQTEMCNEQPCPMTTQVGFMDEQCALTDMKPLYLSLEFPSFYKWVSAVGYTK
GDAMCKHMCRASGKNFMVSRGDRFTDGTRCELSSPAEETAVGLCVMGSCRMFGCDGRMDS
VKRMDMCRVCGGDNTTCFGVKDSYAEGKSREYVTFLRLPPNTTMVHVVNQNPLFTHLGVK
VQGQYVVAGKGRISFNITYPSALEDNRIEYKVFLTVENLPSLEEIHVNGPTQEDIEIQVY
RKYGKEYGAATSPDIAFSYFRPSEKEVHSWVPQLGPCSVSCGEGALKVSYSCFDKARNEM
TDDLHCQKTPRPPARQEPCAVAPCQPQWVAEYFGPCSAPCGGGVMERLVYCAKEERGLNV
TLPDSECVDAPKPSAVESCNTEMCLPRWKESEPGQCSAICGLGVAPVNLTCVQLWDGVES
TMDASLCPADEKPLAFVSCMVNICPLGWNTQEEIPRSELLVPFWPHKTGNRSVYVWSPLA
GACPVTCGGGLMWLSYVCLVFDTREEAEEERCNQAPKPASQLELCNPTPCPASWEVKELS
PCPVTCGGGKIPLSVRCVRRDKNTTRTLPHSKCSRIHRPASSRECAMEPCPARWSYKMGT
CSTSCGRGVMRKVLYCARAMGEKAEEEILPDAVCESLPRPEEQEVCNLEPCPPRWKVTRM
GPCSSSCGLGVATQLVTCMQLSGGQEIELAKSQCREAEKPPFSVPCVIRVCPYEWRVTKW
TQCSASCGNGIQTRQDFCINPETGAWVNPTFCMHSPKPVMLRSCSVAPCLEQATAGPVSR
TDLRTLPPPTEQLMAAVTIGPEKPHHRALDLPQPDGLAPSMKRFEDILWDADEYSPCGQL
FLNSTGFINMTGVQASDCIVAIGRPLGEVLRVQVLESSLNCSAGDVMLFSTRMMWRTGCK
KLVHSTINTRTNTLVVRQRRLGPGNGVSLWYSSKVAAKKYHQDCDVQLFGPSGRIVTPMP
LAGWEQQGACRTFIDVAPRHRIAIHAAYVDPTADSNQTHSSYISVRKLHRIRDVNAMKTA
VFHGNQPFYWESVGSRAEIEFSKDFASVGFQAEYWVTLPK
NT seq 4803 nt   +upstreamnt  +downstreamnt
atgaccctaaatacctgggtggtattttgtgcagtgttccccttgggagtttgctggctg
tcaagaacccaatggacgtttctggattctttggaaactcatgacacttcctcatatttt
ggcaccaattcagtttttgaagtgccagagttcaaagtggtatacctgacttgctcctgt
gaagagggccatgctggacggacatcttgcaaaacccaactttgctcattcagagcctca
ggggaagtctttgccttcaaattcccagatgaccaagccctcttttccacttccttcgtg
agcaaccgaaggctgagctcatccaacagtttgctacgccgtttctggggcaactgtttt
gctgggggacaggtcctcagtcctccaggtgcagaaggccgaatgacatattgtgaaggg
cagctgcaaggatttgtcattgtccatggtgctaaaattcacattaagccagttagaaga
caagaccaagggctgctgatgggcccactccttcccaaacctcacatcatcttaaggacc
caacagaacaacaaaacaacacagacagggcggaggttcccgtcccgataccgcagaggg
gctgaaggggacgtgaaacacttggagcttttggttgtggtgggcccagatgtctttcac
ttccacaaagaagataccgagaggtacatcctcaccaacgtgaacattggagcagagctt
cttcgagatgcgtcactgggagcacagttcagggttcacctagtccaaatgattgtcctc
actgaacctgaggaaggcatcaacatctctaccaacatcacttcctcaatcatcagcatt
tgcaaatgggctgggaaagtcaaccctgagaatgattcggatcctcaccatgcagatcta
gttctgtacgtgaccagatttgacctggaattacctgatggaaacaagcaagtgcgtggt
gtcactcagctgggcggggcctgttccagttcatggagctgcatcatcaccgaggacact
ggatttggtctgggagttaccattgcccacgagatcggtcacagctttgggatccagcat
gatggagaagggaaccgatgtgcaggcgatgggcacatcatgggctctgaaggtggccac
aacagtgtggatttgacctggtccgcctgtagcagagagcagttcttagcctttgtcagt
acaggccaagcaagctgcacaaatgacttgccagacctcaaggacaatatcccaggaggg
aagccaggcctttattatggggtggatgagcagtgcaaaacggcctttgggggcggagct
acagcttgcactttctccaggcacgacattgacatgtgcaaagttctttcttgccacact
aatccagccgaccaatccagctgcactcggatcctcattcccctcctggatggcactgaa
tgtggaatcaacaagtggtgctccaaaggccgctgtagatctttggaagaactgattcct
attgcagcggtccatgggaagtggtctacttggactgcctttactgcctgctcccggagc
tgtggtgggggagtcgtggccaggcggcgacagtgcaacaaccccagacctgcttttggt
ggacgtcagtgtgagggagcagacttgcaaaccgagatgtgtaatgaacagccctgccca
atgacaacccaggtgggtttcatggatgaacaatgtgctttgacggatatgaagccactt
tacctcagccttgagttcccatccttctataagtgggtgtcggctgttggctacaccaaa
ggagacgccatgtgcaaacacatgtgtagggcatctgggaagaatttcatggtgagccga
ggggatcgattcacagatggaacaaggtgtgagctgagcagccctgcagaagagacagcg
gttggcctgtgtgtgatgggcagctgcaggatgtttggttgtgacggtaggatggattct
gtgaagaggatggatatgtgccgagtatgtggtggagacaacactacctgcttcggtgtg
aaggactcttacgcggaaggaaaatccagagagtacgttacatttttgaggctccctcct
aacaccaccatggtccatgtggtcaaccagaacccactgttcacgcatttgggtgtgaag
gtacaagggcagtatgtagtggcagggaaaggcagaatctctttcaacatcacatatccc
tcggccctggaagacaatcggatagaatacaaggtctttctcactgtggagaacctgcca
agcttggaggagattcatgtgaatgggccaacgcaggaggacatagaaatacaggtttat
aggaaatatgggaaggagtatggggctgccactagcccagacattgccttcagctacttc
agaccaagtgagaaagaggtacattcatgggtaccccagcttggcccctgctccgtgagc
tgtggggaaggtgctctgaaggtcagttactcctgttttgacaaggcaaggaatgaaatg
acggatgacctacattgtcagaagaccccaaggccccctgccaggcaagagccttgtgct
gtggccccctgccagccccaatgggtagcagagtactttgggccctgcagcgccccctgt
ggcggtggtgtgatggagcgactggtttactgtgcaaaggaagaaagaggattgaatgtg
accctgcctgattcagaatgtgtggatgctcccaaaccatccgctgtcgagtcctgcaac
actgagatgtgtcttccaaggtggaaggaatcagagccaggccagtgctctgcgatttgt
ggcttgggggttgccccagtgaatttgacttgcgttcaactctgggatggggtggaaagt
accatggatgccagcctgtgcccagcggatgagaagcccctggcctttgtgtcttgcatg
gtgaacatctgccctttgggatggaacacgcaggaagagataccccgctcagagctcttg
gtcccgttttggcctcataagactggaaatcgctcagtgtatgtctggagccctttggct
ggagcatgccctgtcacctgcgggggaggcttgatgtggctgagctatgtctgcctggtc
tttgacaccagagaggaagcagaggaggaacgttgtaaccaggcaccaaagccagcgagt
cagctggaactgtgtaaccccacgccatgtccagcaagctgggaagtgaaggaactctct
ccatgccctgtaacctgtggtggaggaaagatacccctctcggtccgctgcgtccggcga
gacaagaacacaacccggactcttcctcactcgaaatgtagccggatacacaggccagct
agcagcagagaatgtgctatggagccatgcccagccaggtggtcctacaaaatgggcacg
tgtagcaccagttgtggtagaggcgtgatgcgcaaggtcctgtactgtgcacgagcaatg
ggggagaaggcggaggaagagattctaccagacgcggtctgtgagagtttgcctcgccct
gaagagcaggaagtgtgcaacctggaaccatgtcccccaaggtggaaagtgactagaatg
ggtccgtgttcctcctcctgtggacttggggtagccacccagttggtgacttgcatgcag
ctttctgggggacaagagattgagctggctaagagccagtgccgagaagcagagaagccc
cccttcagtgtgccttgtgtgatccgggtctgcccttatgaatggagggtcaccaaatgg
acacagtgttctgcctcttgtgggaatggtattcagacacgacaggatttctgcatcaat
cccgaaactggggcatgggtgaaccccaccttttgcatgcactcccctaagcctgtgatg
ctgcgaagttgctccgtcgctccctgccttgaacaggccacagcaggtccggtctccagg
acagatctcaggactttgccgcctcctacagagcaactgatggctgcagtgaccattggc
cctgaaaagccacaccatagagctttggaccttccacagcctgatggactagctccttcc
atgaaacgatttgaggatatactgtgggacgctgatgagtacagtccctgtgggcagctg
ttcctaaattccactgggttcatcaacatgactggtgtgcaagccagcgactgcattgtt
gccattggccgccccttaggagaggtcctaagggtccaagtgctggagagctccctgaac
tgcagtgcaggtgacgtgatgttgttttctacacggatgatgtggcggacaggctgtaag
aagctggtgcattccaccataaacaccaggaccaacacactggtggtgagacagcgccgc
ctgggtcctgggaatggagtttccctttggtacagcagcaaagtggcagctaagaaatac
catcaagattgcgacgtgcagttgttcggtcccagtgggagaatagtgacccctatgcct
ttggcaggctgggaacaacaaggggcttgcaggacatttattgacgtggctccaaggcat
cgcattgccattcacgctgcatatgtggacccaacagctgactccaaccaaacacactcc
agttacatctcggtgagaaaactgcacagaatccgagatgtcaatgccatgaagaccgca
gttttccatggaaaccagccattctactgggagtcagttgggagcagggccgaaattgaa
ttcagcaaagactttgccagcgtcggtttccaagcagaatactgggtaactttgcccaaa
taa

DBGET integrated database retrieval system