KEGG   Podarcis muralis (common wall lizard): 114590937Help
Entry
114590937         CDS       T06059                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00250  Alanine, aspartate and glutamate metabolism
pmua00270  Cysteine and methionine metabolism
pmua00280  Valine, leucine and isoleucine degradation
pmua00350  Tyrosine metabolism
pmua00360  Phenylalanine metabolism
pmua00380  Tryptophan metabolism
pmua00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmua01100  Metabolic pathways
Module
pmua_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    114590937
   00270 Cysteine and methionine metabolism
    114590937
   00280 Valine, leucine and isoleucine degradation
    114590937
   00350 Tyrosine metabolism
    114590937
   00360 Phenylalanine metabolism
    114590937
   00380 Tryptophan metabolism
    114590937
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    114590937
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     114590937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_binding_3 AlaDh_PNT_C Thi4 MCRA HI0933_like FAD_oxidored NAD_binding_7 Pyr_redox_3 GIDA Lycopene_cycl ApbA 3HCDH_N TrkA_N Trp_halogenase FMO-like NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 114590937
NCBI-ProteinID: XP_028573391
Position
2
AA seq 541 aa AA seqDB search
MDGRMWTNRNMQTNILILSICVFCIPVLSALLFFSALRSCYTDDPSPLEKCFQDAEYENY
LEIAKNGLGKALHPRHVLIVGAGIAGLSAAYTLTEAGHQVTVLEASDRVGGRVETYRNEE
EGWYADLGPMRLPQVHRIAREYVRKFGLSLTEFFPEDENAWYLIDNIRKRVGEVKRNPSL
LNYTVYPSEEGKTAGQLYEESLHQVEEEVKRTNCSYVLGKYDTFSTKQYLIKVAKLSRGA
VEMIGDLLNEDAGYYQSFIESMRAEMIFSSRKRFDQITGGFDQLPIAIYRSISERVHFGT
RVVRMEQAGESVTAFYQTANKALFSVTADYAVVTSTAKATRRIHFEPPLSHNKSHALRSI
HYRSVAKVFLACAEKFWEADGIRGGKSTTDRPSRFVYYVSQNFSGGVGVVLASYVHSDDS
RFFQALSHDDIISITLDDLSAIHQLPKGYIQAVCQSSVIKRWSLDKYSMAGFAAFTPYQF
VDYSEPLEEPEGRIHFAGEHTTKLHGWLDSAIMSGLRAAREINFASGKWLPRNQPNNKEE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagaatgtggacaaacaggaacatgcagacaaatatacttattctatccatt
tgtgtcttttgcattccagttctttcggcattgctattcttttctgccctgcgaagctgc
tacacagatgatcctagtccgctggaaaagtgcttccaggatgctgagtatgagaattat
ctagagatagccaagaacgggctgggcaaagcattgcacccaagacatgtgctgatcgta
ggagcgggcattgcaggcctcagcgcagcctacactctcacagaagctggacaccaggtg
acagttcttgaagccagcgaccgcgtggggggacgagtggagacgtatcgaaatgaggaa
gaaggctggtatgcagatctggggcccatgcgtttgcctcaggtacacaggatcgcccgc
gaatatgtcagaaagtttggcctgagtctgacggaattctttccagaggatgagaatgcc
tggtatttgattgacaacatcaggaagcgagtcggggaggttaagaggaaccccagcctc
ttgaattacactgtgtatccctcggaagaaggcaaaaccgctggtcagctgtatgaggaa
tccctccatcaggttgaagaagaggtgaagaggacaaactgtagctacgtgctgggtaaa
tatgacaccttctcaaccaagcaatatttaatcaaagtagcgaagctgagtcgtggagct
gtcgaaatgattggggacttgctcaatgaagatgctggctattaccagtcgttcattgaa
agtatgagagctgaaatgatcttctcttctagaaagaggtttgatcaaatcacaggaggc
tttgatcagctgccaatagccatttacagaagcatttcagaaagggtgcatttcggtact
agggtggtcaggatggagcaggcaggcgagagcgtcaccgctttttatcaaaccgccaac
aaagcactgttcagcgtgacggccgattacgctgtggtcacctccaccgccaaggccacg
aggcgcatccattttgagccgcccctgtcgcataacaaaagccacgccttgcggtccatc
cactacaggagcgtcgccaaagtcttcctcgcttgcgccgagaagttctgggaagctgac
gggatccgcggtgggaagtccacaactgatcgcccgtcccgattcgtctactacgtcagt
caaaacttttccggtggcgttggggttgtcttggctagctacgtccacagtgacgactcc
cgtttctttcaggccctcagccatgatgacatcattagcatcacccttgatgacctgtct
gccatccaccagctgcccaaggggtacatccaggctgtgtgccagtcatccgtaataaag
agatggagcttggataaatattccatggctggctttgctgccttcaccccctaccagttt
gttgattacagcgaacctctcgaggagccagaaggcaggatccattttgctggggaacac
actaccaaactccacggctggctggactccgcaatcatgtcagggctgagggcagcaaga
gaaatcaactttgcatctgggaagtggttgcccaggaaccagccaaataacaaagaggaa
ctttaa

DBGET integrated database retrieval system