KEGG   Podarcis muralis (common wall lizard): 114591377Help
Entry
114591377         CDS       T06059                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114591377 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmua04040]
    114591377 (GRIA1)
Ion channels [BR:pmua04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   114591377 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659 DUF2061
Motif
Other DBs
NCBI-GeneID: 114591377
NCBI-ProteinID: XP_028574155
Position
2
AA seq 903 aa AA seqDB search
MQHIFAFFCTSFLGAVLGVNFPSNIQIGGLFPTQQSQEHAAFMFALSQFTEPPKLAPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFVTPSFPVDTSNQ
FVLQLRPELQDALISVIEYYKCQKFMYIYDADRGLSVLQKVLDTAAEKNWQVTAVNIMTT
TEEEYKSLFQNLEKKKERVVVVDCESERLNAILGKIIKLGKNGIGYHYILATLGFMDIDL
GKFKESGANVTGFQLVNYTDTIPARIMQQWKSNDAREQPRVDWKRPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGH
RTNYTLHVIEMKHDGIRKIGYWNEDEKLVPTAVDQQGANETTTLQDRVYIVTTILEAPYV
MEKKTNEPLQGNLRYEGYCVELAAEIAKHVGYNYSLQVVADRKYGARDPETKMWNGMVGE
LVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHNEEVEEGRDQPANDQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLDAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVPTTEEGMKRVRRSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRASAAGTSSGENGRVVSHDFPQTMQEIPCMGHSSGTPLGA
TGL
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagtttcctaggggcagtgttgggggtcaat
ttccccagcaacatccagatagggggattatttcctactcaacaatcccaggaacatgcc
gcttttatgtttgcgttgtctcagttcacagagccccccaagctggctcctcagattgac
attgtgaatattagtgacagctttgaaatgacctacaccttctgttcacagttttccaag
ggtgtctacgctatctttggcttttatgagaggaggactgtcaacatgctcacatccttc
tgtggggcactccacgtctgctttgtaacacccagcttccctgtcgacacatccaatcaa
tttgttcttcagctgcgcccagaactacaggatgccctcatcagtgttatagaatattac
aagtgccagaaatttatgtatatttatgacgctgaccggggtttgtcagtacttcagaaa
gtgttggatacagctgcagaaaaaaactggcaggtgacagctgtcaatataatgacaaca
acagaagaagagtacaagtcactcttccagaacctggagaagaagaaggagcgggtggtg
gtggtggactgtgaatcagagcggctcaacgctatcttgggcaagatcatcaagcttgga
aaaaatgggataggctaccactatattcttgcaactctgggcttcatggatatcgactta
gggaaattcaaggaaagtggtgcaaatgtgactggattccagctggtgaattatacagac
accatcccagccaggatcatgcaacagtggaagagcaatgatgccagggaacaacctcgt
gtggactggaagaggccaaagtacacatctgctcttacgtatgatggagttcgagtaatg
gcagaagcttttcagagtctcaggaaacagcggattgacatctctcgccgtgggaatgcg
ggggactgcctagcaaatccagctgtcccttggggacaagggattgacatccagagagct
ctgcaacaggtgcgctttgaaggactgactggtaacgtccagtttaatgagaaaggacat
cggaccaattacacccttcatgtgattgaaatgaaacatgatgggatcagaaagattggc
tattggaatgaagatgaaaaacttgtcccaacagccgtagatcaacaaggagcaaatgaa
accacaactctacaggatagggtctacattgttacaactattctagaagccccgtatgtg
atggaaaagaagaccaatgagccattgcaaggaaatttgaggtacgaaggttattgcgta
gagttagctgctgagatcgcaaaacatgttggctacaactacagcttgcaggttgtcgct
gatcgaaagtatggagcacgagatcctgagactaaaatgtggaatggcatggtcggggag
ctagtatatggaaaagctgatgtggctgtcgcaccactgaccatcactctagtgcgagag
gaagttatagacttttccaagccatttatgagcctgggcatatctatcatgattaaaaaa
ccacaaaagtccaagcctggagtcttttcctttctggatcccttagcttatgagatttgg
atgtgtatagtttttgcctacattggagtaagcgttgtcctctttctggtcagtcgtttc
agtccttatgaatggcataacgaggaggttgaggaaggccgggaccagccagccaatgac
caaacgaatgaatttggaatatttaacagtctctggttttccctgggagcttttatgcaa
caaggatgtgacatatctccaagatctctgtctgggcgtatagttggtggggtctggtgg
tttttcaccttgatcatcatctcttcttacaccgccaatctagctgcgttcttgacagta
gagaggatggtgtctcccatagagagtgcagaagacttggccaagcaaacagagattgct
tatgggactctggatgctgggtctactaaagaattctttaggagatctaaaatagcggtt
tttgagaagatgtggacgtacatgaagtcagctgagccctctgttttcgtgccgacaaca
gaagaggggatgaagcgtgtgaggagatccaaagggaagtatgcctacctgctagagtct
accatgaatgagtacattgagcagagaaagccatgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacgccaaaaggttcaccactgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggagtgtggaagcaaagactccggaagtaaggacaaaacaagtgct
ttgagtctcagcaacgtagccggtgttttctacatcctcatcggtgggcttggactagcc
atgctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaaacggatgaag
ggtttttgtttgatcccacagcaatcaatcaatgaagccatacgaacatcaacccttccc
agagcatctgcggcaggaaccagcagtggagaaaacggacgggtggtgagccacgatttc
ccccaaactatgcaggagattccatgcatgggtcacagctctgggacacccctgggagcg
acgggattataa

DBGET integrated database retrieval system