KEGG   Podarcis muralis (common wall lizard): 114591499Help
Entry
114591499         CDS       T06059                                 

Gene name
FANCD2
Definition
(RefSeq) Fanconi anemia group D2 protein isoform X1
  KO
K10891  fanconi anemia group D2 protein
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    114591499 (FANCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pmua03400]
    114591499 (FANCD2)
DNA repair and recombination proteins [BR:pmua03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     114591499 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 CCDC53
Motif
Other DBs
NCBI-GeneID: 114591499
NCBI-ProteinID: XP_028574431
Position
2
AA seq 1248 aa AA seqDB search
MQMICVSPPPIQHDIITSLPEILEDSQHSEIARELSSLLKEKTELSVPILDALSSLNLDV
GLLSEVRQSVMITVGAVKVEDLPVVVKFILRSVKATDATEVISDLRKKLDLDSCVSLPLI
HVSQTKFRSQTRTSLSASQLCVNQDCVKLLFEVIKSAVKFQKTISEGWIKAIESVASASD
HKVLDLIMLLVIYATNGKNKKQIERVLKNKIQSGCVREQLLRNAFHYYLMVMRDLFPAVL
SLAEIFVHSADPCIVSFGCCMYKQAFTVFDSYCQQEIVGALVTHACGGNNIAVDVSLDML
IDLVSLHTSSIVPYAVFLKSILDYMDNLSPQQIRKLFQILSMLAFSQGHKSNHIQDDMHM
VIRKQLSSTIPKYKRIGIIGAVTMVGSMAAKRSKENGQLLERAQLSKEQCRQIISLLELV
CSCCGQVPQALALYYDELANLIQKGNLDSQILEWIENSVEKDFERDFVTDLLPIEDSAFL
LPVKSLYSLEDDKSEGIIAINLLPLLSQSYLSKNVDEVAAKSHDKRVVSPLCLSPFFRLL
RLCMAELNQGSLDDVDALLGCPLYLTNLEVVGKLDSLSKQEREFLCSLLFHALNWFREVV
NAFCQQDDPEIKGKVLTRLQNITELQCLLEKCLAASPGYVPPLANFDSETSEGVPVINTI
GATKKKSKGQKTPKSDNGKNGSADNSQLDENTEANQPEAEISQPEKDSTEKEPETPLVPL
QSYSAYFRELDLEVFSIIHSGLLTKSALDTEMHTKTHEVVQIGPTQLLFLLDDLSRKLEH
MLIPAAAKRAPFFKGKGNRNVGFSHLCQRSSQEVIEYAVELLKPLCSHMENMHNYFQALI
AENHGVIDGPRVNIQEHHLMSSCYQRLLQVFHLLFAWSGFSQHENHSLLKSGLRVLAHRL
KPGERDLPLEELLSQSFQYLLNFQHSIPNIYCALSLTQLLLVITEKSGTSQKSNEIASIT
KHFLCQSWLQPSGIRQKGTQFNDALHTLFCIYMEHTDNILKAIEDICSVGIPQLIQSSKD
EYSSTYPTLTRQTFPVFFRVMMAQLETSAKSISAGKPSDSSEVQLEKLLRWNLAVRDFHI
LVNLVKVFDSRPVLSACLKYGRLFVETFLKLGMPLLDCSFKKHREDVQSLLKTLQLSTRQ
LHHICGHSKIHQDTGLTSHVPLLKKSLELFVYRVKAMLALNHCQEAFWVGVLKNRDLQGE
EILSQASQASKMEEEISKLPTEEEEEEGEDSENEDGMDIKDSDEDSSD
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgatttgtgtttctcctccaccaatccaacacgacataatcacaagcctgcca
gaaatcctagaggattctcagcatagtgaaattgccagagagcttagttcgttattaaag
gagaagactgagctatctgttccaatccttgatgccctttccagtttgaatctagatgtg
ggacttctgtctgaggtgcgccaatctgttatgatcacagtcggtgctgtaaaagtggaa
gatttgcctgtagtagtaaaatttattctccgttccgtcaaggccacagatgcaacagag
gtaatttctgaccttcgtaagaagctggacctggactcgtgtgtttcacttccactgatt
catgtttctcagaccaagttcaggagccagactcggacaagtctgtctgcaagccaactg
tgtgtcaaccaggactgcgtcaagcttctttttgaagttataaagtctgctgttaaattc
cagaagaccatttcagaaggctggattaaggccattgaaagtgttgcttctgcctctgac
cataaggttctggatctgataatgctgttagtaatctatgctacaaatggcaagaacaag
aagcagattgagagagtgctgaaaaacaagattcaatcaggctgcgtaagagagcagttg
ctgcgcaatgccttccattactacttaatggttatgagagacctctttccagctgtcctg
tcactggctgagatctttgtacactcagcagatccctgcattgtctcttttggctgctgt
atgtacaagcaagcattcacagtctttgactcttattgccagcaggagattgtgggtgcc
ttggtaactcatgcatgtggtggcaataatattgcagttgatgtctctctggatatgctc
attgacctggtgtctcttcacacttcatccatagttccttatgcagtctttctgaagagc
attttagattatatggataatctaagtccacaacaaatccggaagctattccagattctt
agcatgctggcattcagccaggggcacaaaagcaatcacattcaggatgacatgcatatg
gtgatcaggaagcaactctccagcactattccaaagtataagcgcattggtattattggt
gcagttaccatggtgggaagcatggcagcaaagaggagtaaagaaaatggacagctattg
gaacgggcacagctgagcaaggagcaatgtagacagattatatctttactagagctggtt
tgctcttgctgcggacaggtcccccaggccttggctctctattacgatgaactcgccaac
ttgattcaaaaagggaatttggattctcagatcctggagtggattgagaacagtgtggag
aaggactttgagagagattttgtgacagatcttctccctatagaggacagtgctttcctg
ctcccagtgaagtccctgtatagcttggaagatgacaaaagtgagggaataattgctatt
aacttgttgcctctgctgtcccagagctatttgagcaagaatgtagatgaagtagcagct
aagagccatgacaaaagggtagtgtctcctctgtgtttgtcaccattcttccggctgctg
agactctgcatggcagaactgaatcaagggagcttagatgatgttgatgccctattaggg
tgtcctttgtatctgaccaacttggaggtggtaggaaagttagattccttatcgaagcaa
gagcgtgaattcctctgttctcttctatttcatgccctcaactggttccgtgaggtggtg
aatgccttctgtcaacaagatgaccccgagataaaggggaaagttttgactcggttacag
aacattacggagctacagtgtctgctggaaaaatgcttggcagcaagccctggatatgtt
ccccctcttgcaaattttgattctgaaacctcagaaggagtacctgtcatcaataccatt
ggtgccaccaaaaagaagagcaaagggcaaaaaacccccaaatctgataatggcaaaaac
ggttctgcagacaactcacagctggatgagaacacagaagcaaatcagcctgaagctgag
atcagccagccagagaaggactccacagaaaaagaaccagagactcctttggtaccactg
cagagttatagtgcgtatttccgtgaactagacttagaggtttttagcattattcacagt
ggcctgctgaccaaatctgctctggatacggagatgcacacaaagacccatgaagtggtg
cagattgggccaacacagcttctgttccttttggacgatctgagtcgtaagttggaacac
atgctgattccagctgctgcaaagagagcccccttttttaagggaaaaggaaatagaaat
gttggattctcacatctttgtcaaagatcatctcaagaagtgattgaatatgctgttgaa
ctcttgaagccactgtgtagccacatggaaaatatgcacaactacttccaggcactgatt
gcagagaaccatggtgtgattgatgggccaagggtcaacattcaagaacaccacctcatg
tcatcctgttaccagcgattattgcaagtctttcaccttctgtttgcttggagtggattt
tctcaacacgaaaaccatagcttgctgaaatctggtctccgggtcctagcacatagactc
aagccaggggagagagatctccctcttgaggagttgctcagtcagagttttcaatactta
ctgaacttccagcacagtattcccaacatttattgtgcactgagcctcactcagcttctg
cttgtcattactgaaaaatctgggactagccagaaaagcaatgaaatagcttccatcact
aaacattttctctgccaatcatggctgcagcccagtggaattcgtcagaagggcacccag
tttaatgatgctctccacactttgttttgtatctatatggagcacacagataatatattg
aaggcgatagaagacatttgcagtgttgggattccgcagctgattcagtcttctaaagat
gaatactcttccacttaccctacattgaccaggcaaacttttccagttttcttccgagtg
atgatggctcagctagaaacctcagcgaaaagcatttctgctggaaaaccatcagattcc
agtgaggtccagctagagaagttgctacgctggaacctggctgtccgggatttccacatc
cttgttaatttagtcaaggtatttgacagtaggcctgtgctcagtgcttgcctgaagtat
gggcgtctttttgtggaaacattcttgaagcttggcatgcccctattggactgcagcttt
aaaaaacacagggaggatgtgcagagtttgctgaaaaccttgcagctgagcactagacaa
cttcaccacatatgtggccattccaagattcatcaagacacaggactcaccagccatgta
ccgctactgaagaaatcccttgagctgtttgtttaccgagtgaaagcaatgctggctctc
aatcattgtcaggaagctttctgggtgggcgtcctcaaaaacagggatctgcagggagaa
gagattctttcacaggcatcccaagctagcaagatggaggaggagatttccaagcttccc
acagaggaggaggaggaggaaggggaagattcagagaatgaagatgggatggatatcaaa
gacagtgatgaagacagctctgattag

DBGET integrated database retrieval system