KEGG   Podarcis muralis (common wall lizard): 114594660Help
Entry
114594660         CDS       T06059                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04068  FoxO signaling pathway
pmua04110  Cell cycle
pmua04218  Cellular senescence
pmua04350  TGF-beta signaling pathway
pmua04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114594660 (TGFB2)
   04350 TGF-beta signaling pathway
    114594660 (TGFB2)
   04068 FoxO signaling pathway
    114594660 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114594660 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114594660 (TGFB2)
   04218 Cellular senescence
    114594660 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114594660 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114594660 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:pmua00536]
    114594660 (TGFB2)
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   114594660 (TGFB2)
Glycosaminoglycan binding proteins [BR:pmua00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114594660 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2 RNase_H_2
Motif
Other DBs
NCBI-GeneID: 114594660
NCBI-ProteinID: XP_028580453
Position
3
AA seq 413 aa AA seqDB search
MHCYLWSVFLTLDLATVAFALSTCSTLDMDQFMRKRIEAIRGQILSKLKLNSPPEEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCEKERSDEEYYAKEVYKVDMQPTFQSANLIST
NHPIPYFRRVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVSEQRIELYQVLKTKDLTSP
MQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDYYTYPSGEKSLKPSRKKNSGKTPHLLLMLLPSYRVESQQSSRRRK
RALDAAYCFRNVQDNCCLRPFYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHS
RVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctacctttggagcgtcttcctcaccttggatctggccacggtggccttcgcc
ctgtcgacgtgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaagcgatc
cgggggcagatcctgagcaaactgaaactcaacagccctccggaagagtacccggagccc
gaggaggttcctccggaggtcatctcgatctacaacagcaccagggacctgttgcaggag
aaggcgaaccacagggcagctacttgcgagaaggagaggagcgacgaggagtattacgcc
aaagaggtttacaaagtagacatgcagcctactttccagtccgcaaatctcatctcaaca
aaccaccccatcccctattttagacgagtgagatttgatgtctcggcgatggaaaaaaac
gcttccaacctggtgaaggcagaatttagagtctttcggttgcagaatccaaaggctcgt
gtctcggaacaacggatagaactgtatcaggttctgaaaaccaaagatctaacatcacct
atgcagcgctacattgatagcaaggtagttaaaaccagagctgaaggcgagtggctatct
ttcgacgtaactgatgcagtacatgagtggctccaccaccgagacaggaatcttggattt
aagataagtttacactgtccatgttgcacattcgtgccttcaaataattatatcatccca
aataaaagtgaagagctagaagcaagatttgcaggtattgatgactactacacatatccc
agtggtgagaaatctttaaagcccagtaggaaaaaaaacagtgggaagaccccacatctt
ctgctaatgttattgccctcctacagagttgagtcgcaacagtccagtcggcggaggaag
cgtgctctagatgctgcctattgttttaggaacgtgcaagacaactgctgcctgcgccca
ttttatattgacttcaagagagatctgggatggaaatggatacatgagcctaaaggatac
catgcaaatttctgtgcaggagcttgtccttatttatggagctcagatactcagcatagt
agagttctcagcttgtataacactatcaacccagaagcctctgcatctccatgctgtgta
tcccaagatttggagcccctcaccatcttgtattacattggaaaaacgcccaaaatcgaa
caactttctaacatgatcgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system