KEGG   Podarcis muralis (common wall lizard): 114596081Help
Entry
114596081         CDS       T06059                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00780  Biotin metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    114596081 (HLCS)
Enzymes [BR:pmua01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     114596081 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     114596081 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     114596081 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     114596081 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C Herpes_UL92
Motif
Other DBs
NCBI-GeneID: 114596081
NCBI-ProteinID: XP_028582979
Position
4
AA seq 912 aa AA seqDB search
MLITLCYLYLWARWGASSAGLIRRTVRRLYRTRCSFTFSTSSSSSPGCPRQTPQHQQAAH
HPLRRQGPRRPPEEERVCLRVGDKVFFTDETQSVDDLNKWTLLIVSPFHYLDKILETERI
TFLTESISIQAGSSQAVNCSAEKIVKWSDYCSPLAFRPGEPYILFAETSIDNFSSLGIAF
MENRLQMDNGMKPQKIVSVHLQKSALEELEQLAPNTPKEGNTNKMPLGELTQGSTFKTDA
KPEEEALDCAAGGDQEMQRSACKLQKVNEHPEQLEQISEKETGTGEHHHLHLSSCHECLE
LENSTIESVKFASAENIPDLPDDYSGNSEDVSDNLAGNLKRVNLTGKPPNILIYVGSDPG
KVKFEEIKSLIMECVDVNAYTVYQLLENQVMSVPWLDNALLLIVAASHPISDDVSKQFLA
FMSKGGKILGLASSFTFGGIQLKSKDELMGKIQDFVFSTAKSKEVRLNILASGKVFERET
TEELSPMKLLGYLGSPDKDMVIVHLPYGNGGGEAILCQAHLEVNVKGLSTQTKDDFNLLK
MSNAKRYDVLTEILTLLHLSCDLSEVPQLTPIYLLSSDKDVHGLFLGWLERNVNAEGLIR
SNMVSLKFVSSCIKGTEVTPSLMPVVTEMEAFSSEHFSFERYRQNLHTKKLGKVVLFAEV
TSTTMNLLDGLMYKVPQEIGLIAIAVQQTQGKGRGGNAWLSPVGAALSTLHITIPLSSEL
GRRIPFIQHLVSLAVVESVRSIPGYQDIELRVKWPNDIYYSDLMKLGGVLVNSTLTGDTF
HILIGCGFNVNNSNPTICINDLIMEHNKTKNTELKPLSADYLIARSVTVLESLINTFQEK
GPNGVLPMYYKYWVHSGKQVRLGSDEGPLAWIVGIDDSGYLQVHEEGKDVVTVHPDGNTF
DMLRNLIIPKQQ
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcacgctctgctacttgtacttgtgggcgcgctggggggcctcttcggcgggg
ctcatccgccgcacggtgcgcaggctgtacaggacccgctgctccttcaccttctctacc
tcctcttcctccagtcccggctgccctcgccaaactccgcagcaccagcaagctgcccac
catccgcttcgcaggcaggggccccggcgccccccggaggaggagagagtctgcctgagg
gtgggggacaaggtcttcttcactgacgagacccagtctgttgatgatttaaacaaatgg
acgttgcttattgtatcgccttttcattatttggataaaatattggaaacagaacgtatc
acatttctaactgaaagtatttccattcaagcaggcagttctcaggctgtaaattgctca
gcagaaaagattgtgaagtggtcagactattgttcacctttggccttcagacctggcgaa
ccttacatattatttgctgaaacaagcatagataacttcagtagccttgggatagcattc
atggaaaatagactccaaatggataatggaatgaagcctcaaaaaattgtgtctgttcac
ttacagaagtcagcgctggaagagttagaacaactggctccaaataccccaaaagaggga
aatactaataagatgccacttggtgaactgactcaagggtctacttttaagactgatgct
aaaccagaagaggaagctcttgattgtgcagcaggtggcgatcaagaaatgcagagatca
gcatgtaaattgcagaaagtaaatgaacatcctgaacaacttgagcaaatatctgaaaag
gaaacaggaactggtgaacatcaccaccttcatctttccagctgtcatgagtgcttggaa
ctggagaatagcacaattgagtcagttaagtttgcctctgcagaaaacattccagatctt
cctgatgattatagtggcaattccgaagatgttagtgataatctggcaggaaacctgaaa
agggtaaaccttactgggaagcctcctaatattttaatttacgttggttctgaccctgga
aaagtgaagtttgaggaaataaaatcactcatcatggaatgtgtagatgttaatgcttat
acagtctaccagttgttagagaatcaagttatgagcgttccatggcttgacaatgcattg
ctgttgattgttgctgcatcacaccccatttcagatgatgtgtccaaacaatttcttgct
tttatgtcaaaaggtgggaagattttgggacttgcttcttctttcacttttggtggaata
cagctaaaaagtaaagatgaactgatgggcaaaatacaggacttcgtgttttcaacagca
aagagcaaagaggttagactaaatattctagctagtgggaaagttttcgagagagaaact
acagaagaattaagccccatgaagctactaggttacttggggagtccagataaagatatg
gtgattgtccatctgccctatggaaatggtggtggagaagccattctttgtcaggcacat
ttggaagtgaatgtcaagggtttgtctactcaaacaaaggatgacttcaatttgctcaaa
atgagcaatgccaaaagatatgatgttcttaccgaaatcctgacactacttcatttgagc
tgtgatttaagtgaagttccccaattaactcctatttacttgctctcatctgataaggat
gtccatggtttatttttggggtggcttgaaagaaatgtgaatgcagaaggattaatcaga
tccaacatggtgtccctcaagtttgtatcatcttgcatcaaaggaacagaagtaacaccc
tcgctcatgccggtagttactgagatggaagctttctcatccgaacatttcagttttgag
agatacaggcaaaatctacatacaaagaagcttgggaaagtagttctctttgctgaagtt
acatcaaccaccatgaatcttcttgatgggttgatgtacaaggtgccacaggaaataggt
ctgattgcgattgcagttcaacaaactcaagggaaaggccgtggtgggaatgcttggctg
agtcctgtgggagctgctttatcaactctacatatcaccattcctttatcttctgaactg
ggacgaagaattccttttattcagcatttggtttctctagcagttgtagagtctgttaga
tccatacctggataccaggatattgagcttcgagtgaaatggccaaacgatatttactat
agtgaccttatgaagctgggtggcgttttagtgaattccacactaacaggagatacattc
cacattcttattggctgtggatttaacgtgaataacagcaaccccactatatgcatcaat
gatctcattatggagcacaataagacaaagaatacagaattaaagcccttaagtgcagat
tacctgattgcaagaagtgtgacagtgctggaaagtctgatcaacacctttcaagagaaa
ggacctaatggagttcttcccatgtactataagtactgggtgcacagtggtaaacaagta
cggcttggaagtgatgaagggcctttagcgtggatcgttggaatagatgattccggatac
cttcaagttcatgaggaaggcaaagatgtagtaaccgtgcacccagatggcaatactttt
gatatgctgagaaacctgataattccaaaacagcagtag

DBGET integrated database retrieval system