KEGG   Podarcis muralis (common wall lizard): 114596381
Entry
114596381         CDS       T06059                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmua03021]
    114596381 (AFF3)
Transcription machinery [BR:pmua03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     114596381 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 114596381
NCBI-ProteinID: XP_028583724
Position
4
AA seq 1235 aa
MTYPSSDLTMDSFDLALLQEWDLDSLCVYDPDRNMLRRKEWERRNQETQHEDGIFNNSYS
LFSEPYKTNKGDELSSRIQNTLGNYDEMKELLTDRSNQSHLVGVPKPCISQTSVTKAEEH
FIADTKPHTHASPSSLPAALSGQLGKNPAMGWQKSGHTLENQQRGSKHRHGLPDAHNNDF
KTVSQKNSLEKITHYASNPSSPSPSSVAQSPLSSSLGNNSRTQQQLSKLSFGGEGGAQAQ
ERPAMHSNGHCVQNFPPSLASKLSIVQQKPTAYVRPMDGQDQAPEESPRLKVPAETSLLC
TSYRGMPSAKADSARTKSKLAKFNIPKQEEDNGEGDDSCVEEILREMTHSWPPPLSAIHT
PGKVEQNKFPFTNKDSQQHVSTGHSNQRKGDVESKNPENSTSHTSMLEDDLKLSSDEEEN
DQQAAQRSALRVLSDSTTVQQSSCRIAGITSKCSSSSSSSESESSSESDSESESSSTESD
SKKPSHYSSPEPEQPSSNKWQLDKWLNKVTSHKAPILNQNGLELFQCYSKGKDEGQDCEH
LPPICQTGLRDKEVKNPSKEDLRPRTANKAPGHKGGKQKSPPSAAAISGDSGPLRRTACK
KQPRRTERTSGGDILNGHAADDLDLNQVHLENNSTCEQPKTRPCNNKVEHRKETRAVCEK
RRTRGSGKTAPKSKEFIETDSSSSTSSDTDSQSEQEDYPLHKPQTVTSASAGSDQKLKDP
GSNNTNKPNSSCSAFGSVNTRTSNDIAKELEEQFYTLVPFGRNELLSPLKDTDEVKALWV
KIDLALLTRIPQHLPEEPLQINAGVKEAISMQHNIVTDLPAEKVIPKSRRKRKYENEEEN
RESKKIHTEQECASHLLASAQVASAPNNCNMIKNSLATPINKNEKMLRSPVSPISDASKH
KFSGDDLTSSSKPQGGNLLSSISSIKKHKNESRSHLHQGDFNKAMYINSENSVLCSKAQC
QKEPWSPVSIMHKDCRRTKLIFNDGPHNVEHFMQEAKRKKHKADAMVEKFGKALNYAEAA
LSFIECGNAMEQGPMESKSPYTMYSETVELIRYAVRLKPHSGPNAIPEEKQLTTLCYRCL
AILYWRMFRLKRDHAVKYSKALIEYFKNSSKVAQVPSPWGASGKYTGTPSPVSPSPSPVS
SVGSQGSTRAPSPSSIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENQDFFND
LDALMGPVTLHSSMEHLVQYTKQGLHWIKSSTQLS
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgacatatccttcctccgacctcaccatggacagcttcgacctggctctcctgcaggaa
tgggacctggactccctctgtgtctatgaccctgacagaaatatgctgcgcaggaaagaa
tgggaaaggagaaatcaggagacccagcacgaagatggcatatttaataacagctactcc
ctcttcagtgagccatacaagactaacaaaggggacgagctctccagccgtatccagaat
accctgggcaactacgatgagatgaaagaactgctgactgatcgatccaatcaaagccac
cttgttggtgttccaaagccatgtatctcacaaacgtctgtgaccaaagctgaggaacac
ttcattgctgacacaaagccccacactcacgcttctccatcttccctaccagcggcactt
tctgggcagttgggcaagaaccctgcaatgggttggcagaagtctgggcacaccctggag
aaccagcaaaggggaagcaaacatagacatggattgccggatgcacacaataacgacttt
aaaacggttagccaaaagaacagtttagaaaagattacacattacgcatccaatccctca
tcaccatctccgtcgagtgttgcccaaagtcctttatcgtcttcacttgggaacaacagc
agaacacaacagcagctgtcaaagctgagttttggtggagaaggtggagctcaagctcag
gagaggccagctatgcatagcaatggacactgtgtgcagaactttcctccttcacttgct
tcgaagctcagcatagttcagcagaaaccaacagcatatgtaaggccaatggatggtcaa
gatcaggctcctgaggagtctccaagattgaaggtgccagctgaaactagcctgctctgc
acctcatatagaggaatgccttctgccaaagctgactcagctaggacaaagtcaaaattg
gcaaaatttaatattcccaaacaagaagaggacaatggggaaggagatgacagctgcgtt
gaagaaattttacgggaaatgacccattcatggcctccgccactttctgctattcacaca
cctggcaaagtggaacaaaacaagtttcctttcaccaacaaggactcccagcagcatgtc
tctacggggcacagcaatcaaagaaaaggtgatgttgaatcaaagaatccagaaaacagt
acatcacatacatcgatgttagaagatgacctcaagttgagcagtgatgaagaggagaac
gaccagcaggcagcacagagatctgctctccgggttctatccgacagcaccactgtgcag
cagtccagctgcaggatcgcggggatcaccagcaagtgctcaagcagcagcagctccagt
gaatctgagagcagttcagaatccgactcagagagtgaaagcagttctaccgagagcgac
agcaagaagccctctcattactccagcccagagcctgaacagccatcgtcaaacaagtgg
cagctggataaatggttaaataaggttacttcacacaaggcacctattctgaaccaaaac
ggactggagctctttcagtgttacagcaaagggaaagatgaagggcaagactgtgaacat
ttacctcccatttgccaaaccggtctcagagataaagaggttaagaatcccagcaaggag
gacctgaggcctaggacagctaacaaagccccggggcataaaggagggaagcagaaatcg
cctccttcggctgctgccatttctggagatagtggtcctctgaggaggacagcctgcaaa
aaacagccaagaaggacagagaggacctctggtggtgatatcttaaatggccatgcagct
gatgatcttgacttgaaccaagtacatttggaaaataatagcacatgtgaacaacctaaa
accaggccttgcaacaacaaagttgagcacaggaaggaaacacgtgctgtctgtgaaaag
aggcgtacaagggggtcaggtaaaacagcacccaaatccaaggaatttattgagacagat
tcttcgtcttcaacgtcctcagatacagattctcagtcagaacaagaggattacccttta
cataagcctcagactgtgacctcagcatcagctggaagtgaccagaagctgaaagaccct
gggagtaataataccaacaaaccaaacagcagttgtagtgcctttggttcagttaacacc
aggactagtaacgatatagcaaaggaactggaagagcagttttacaccctggttccattc
ggtcggaacgagctcctatctcccctgaaagacacagacgaagtgaaagcactttgggtc
aaaattgatttggctcttttgaccagaattccacagcacttacctgaggagccactgcaa
attaatgctggagttaaagaagcaatcagtatgcagcacaacattgttactgatctgccg
gcagaaaaggtcatccccaaatctagaaggaaacggaagtatgaaaatgaggaagaaaac
agggagagcaagaagattcacactgagcaagagtgcgcttcacatttacttgcttcggcc
caagttgcttctgcaccaaataattgcaatatgattaaaaacagcttggcaacaccaata
aataaaaatgagaaaatgcttcgatcgcctgtttcacccatctctgatgcatcaaagcac
aaattctctggtgatgatctaacttcttctagcaagcctcagggtggcaacctattatct
tccatatcctcaataaaaaaacacaagaatgagagtcgttcccacttgcaccaaggagat
ttcaataaagcaatgtacatcaattcagaaaattctgtactctgtagcaaggcacagtgc
caaaaggagccctggtcacctgtatctattatgcacaaagactgtagaagaacaaagctt
atctttaatgatgggccacacaatgtggaacactttatgcaagaagctaaaaggaagaag
cataaagcggatgcaatggtggagaaatttggcaaggcgttaaattatgctgaagctgca
ctatcctttattgaatgtgggaatgctatggaacaaggacccatggaatccaaatccccc
tacacaatgtattcagaaacagttgaacttattaggtacgctgtgaggctaaaaccccac
tcaggccctaatgccattccagaagaaaaacagttaacgacattatgttaccgctgcctg
gcaattctatattggagaatgtttcgactcaaaagagaccatgccgtaaaatattcaaaa
gcacttattgagtatttcaagaattcatctaaagttgctcaagtaccgtctccctggggt
gccagtggaaagtatacgggaacaccctctccagtttcacccagcccatctcctgtgagt
tctgtagggtcccagggaagcactagagccccctccccctcctccatcatcagcattcca
caacggattcaccagatggcagccaatcacgtcagcatcaccaacagcatcttgcacagt
tatgactactgggagatggctgacaaccttgccaaggaaaaccaagatttctttaatgat
ttggatgcactgatgggacctgtcaccttgcacagcagtatggaacacctggtacaatac
accaaacaaggactccactggataaagagcagtactcagttgtcataa

DBGET integrated database retrieval system