KEGG   Podarcis muralis (common wall lizard): 114597481Help
Entry
114597481         CDS       T06059                                 

Definition
(RefSeq) guanylate cyclase 2G-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114597481
Enzymes [BR:pmua01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114597481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA
Motif
Other DBs
NCBI-GeneID: 114597481
NCBI-ProteinID: XP_028586117
Position
5
AA seq 1078 aa AA seqDB search
MPKLVIAFQAPWNISHPLSGQRLCSAVEIAINKVNADPSYLGNYSLEFIYADSGCEAKKS
LHAFINQFQKEHISALFGPVCSEAAEVTGLLASQWNIPMFGFVGHTAKLEDSFVYDTYIN
LVTPLQMIGEVLYKTLQYFGWRYVGLFGSSSDVFTWAETEELWASVENQLKSNITITAKV
RYNTKDQSLHQDKLNYIASVARIIVLICSSLDARSILLEAKKLGMTNGPYVFFVLQQFED
NFLKETWSNGNSSVLDAYQPVLLIALRSYREYKTYSDFVKEVHSKLKEKQLSGSFFSSHG
EVSSYAAYLHDAVLLYALSIKEMLEGKKDFHDGKALVNSLKGYNKTPMYGITGPVNIDEL
GERNMDYSVYDLQEFGNSVHFIPVLNFDSVRKTISPTRQIDYISWADGEIPKDKPLCGFH
NEHCKTPVTSSALIVMIILLIISVLGAIGVAMYMKTHKGNLRNDTWWRINYEDIIILNDN
KGNVCLSQASTPVSKGTESLGSHLFISNNDDSGVKNKRGKEVFYTTVGLYQESRAQTAQQ
NKSQNKSQDSQGIVVALKFIDNQIDAWIRKPSVLQEVRVMRELRHENLVAFYGICPEAPN
MCIVMHYCKKGSLKDVLMHSDIELDWIFKISFAYDIVNGMVFIHNSPLNSHGNLKPTNCL
VDSRMQVKLCGFGLWEFKYGRKSQVMTEESNYAELYWTAPELLRMAEYPFHGTQKGDVYS
FAIIMRELIYNHEDGPFHDLSQNAEEIIKRIQDPNSPVPLRPSISTQKCNERIVALLKAC
WDEYPERRPTFLNIKRALKDASPEGSHFGILDNMVNKLEKYANHLEEVVESRTTQLMAEK
KKTEKLLSAMLPGFIGEQLVAGKSVEPESFDSVSIFFSDIVGFTKLCSLSSPLQVVNLLN
DLYSLFDNIIKNYDVYKVETIGDAYMVASGLPIRNGKKHVEEIATMSLHFLNAIISFKIR
HMPKEKLSLRIGIHTGPVVAGVVGITRPRYCLFGDTVNVASRMESTSLPLQIHVSMITAN
VLQMIGGYDLQERGTIRIKGKGQQRTFWLKGKVGFHLPLPEFGSDVESRPKGNAEVDM
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcttgtaatagcctttcaggctccttggaatatctcccatcccctgagtggc
caaaggttatgctctgctgtcgagattgccatcaataaggtcaatgcggatccatcttac
ctaggcaattacagcttggagtttatttatgctgactctgggtgtgaagcaaagaagtct
ctgcatgctttcatcaaccagtttcagaaagaacacatttctgccttgtttggaccagtt
tgctcagaggcagcagaggtaactggtttgctagcttctcagtggaacatccccatgttt
gggtttgttggccatacagccaagctggaagattcctttgtttatgacacttatatcaat
cttgtcacccctctgcaaatgatcggggaagtcctttataaaactctccagtattttggg
tggaggtacgttggcctctttggaagctcaagtgatgttttcacttgggctgaaacagag
gagttgtgggcttctgtagaaaatcaactcaaaagcaacatcaccatcactgctaaggtg
agatacaacacaaaagatcaaagcctccatcaagacaagctcaactatatagcatcagtt
gccagaattattgttttaatctgcagttctttggatgcaagatctattttgttagaggcc
aagaaactaggtatgacaaacggaccatacgtgttctttgtgctgcagcagtttgaggac
aattttttgaaagagacttggagtaatgggaacagcagcgtcctagatgcctatcagcct
gtgctgctcatagctctcagatcttacagagaatacaagacctattctgattttgtgaag
gaagtccacagcaagctgaaggagaagcagctttcaggcagtttcttttcttcacacgga
gaggtaagttcttatgctgcctacctacatgatgctgttttgctttatgcgttatccata
aaagaaatgttagaagggaaaaaggacttccatgatggaaaggcccttgtcaacagtttg
aaaggttacaacaaaactccaatgtatggcattactggcccagtcaacattgatgaatta
ggtgagaggaacatggattactctgtgtatgatctccaggaatttggcaactcagttcat
ttcattccagttcttaactttgacagtgtcaggaaaacaatcagcccaaccagacagatt
gactatatcagttgggcagatggagaaatacctaaggacaaaccactgtgtgggtttcac
aatgaacactgcaaaactccagttaccagttcagccctgattgttatgataattctgctg
ataatatcggtattgggggccattggtgtggcaatgtatatgaaaacccacaagggaaac
cttcgaaatgatacgtggtggagaattaattatgaggatatcatcattttaaatgataat
aagggaaacgtctgtctgtctcaagcaagcacaccagtgtccaaaggaacagagagcttg
ggctcccatttgtttatttctaataatgatgattctggagtgaagaacaagcgagggaaa
gaagtattttacaccactgtaggactttatcaggagagcagggcacaaactgcccaacag
aataaaagccagaataagtcacaggattcacagggaattgttgttgctctcaaattcatt
gataatcaaatagatgcatggatccggaaaccatcagttctccaggaggttcgggtgatg
agagaattgagacatgagaatctggtggccttctatgggatatgtcctgaagctccaaac
atgtgcattgtgatgcattactgtaagaaaggtagcctaaaggatgttttgatgcattct
gatatcgaactggactggatattcaaaatctcctttgcctatgacatagtcaacggtatg
gtgttcattcacaacagccccctgaattctcatggaaacttaaagcccaccaactgcctg
gtagacagtcgcatgcaggtgaagctgtgtggctttgggttgtgggaatttaaatatgga
aggaaatctcaggtaatgacagaagaaagcaattatgcagagctttactggacagcacct
gaattgctaagaatggcagaatatccattccatggcacacagaagggggatgtgtacagc
tttgctattattatgagagaactgatatacaatcatgaagatggtccattccatgatcta
agccagaatgcagaagagataataaaaagaatccaggaccctaattctcctgttccactg
cgcccttccatttcaacacagaaatgtaatgaaaggatcgttgcacttttgaaggcatgt
tgggatgaatatccagagaggaggccaacattcctcaacatcaagagagcacttaaagat
gccagtccagaaggaagtcacttcggtatcttggacaacatggtgaataaactggaaaaa
tacgcaaatcatctggaggaagtggttgagtcaaggacaactcagctgatggcagagaag
aagaagacagaaaagcttttatcagctatgctacctggtttcattggagaacaacttgtt
gctgggaaatcagtggaacccgagagctttgattcagtctccatcttcttctcagacatt
gttggcttcaccaagctatgctctctcagctctccattgcaggttgtgaatctcctcaat
gacctgtacagtctgtttgataacatcattaaaaactacgatgtctacaaggttgaaact
atcggagacgcctatatggttgctagcggcctccccattcgcaacgggaagaaacatgtt
gaagaaattgctaccatgtctttgcactttctcaatgcaatcatttccttcaagattagg
cacatgccgaaggagaaactgagcctgcgtattggtattcatacaggccctgttgttgca
ggtgtggtggggatcacaaggccacgttactgcttgtttggagacacagtgaatgtggct
tcaaggatggaaagtaccagcttacctctccaaatccatgtctctatgatcacagcaaat
gttctccagatgattggaggttatgatttgcaggaaagagggaccataagaataaagggc
aaaggacagcaaagaacgttttggctgaaaggaaaggttggattccatctgcccctacca
gagtttggcagtgatgtagaaagccgcccaaagggaaatgctgaggtagacatgtag

DBGET integrated database retrieval system