KEGG   Podarcis muralis (common wall lizard): 114597653Help
Entry
114597653         CDS       T06059                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04136  Autophagy - other
pmua04140  Autophagy - animal
pmua04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114597653 (ATG16L1)
   04136 Autophagy - other
    114597653 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114597653 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114597653 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:pmua03029]
    114597653 (ATG16L1)
Membrane trafficking [BR:pmua04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    114597653 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    114597653 (ATG16L1)
Mitochondrial biogenesis [BR:pmua03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    114597653 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Fez1 SGL Phostensin_N KASH_CCD HTH_6 Lipoprotein_6 Med28 Filament Synaptobrevin ERM Vps39_1 V_ATPase_I YabA
Motif
Other DBs
NCBI-GeneID: 114597653
NCBI-ProteinID: XP_028586538
Position
5
AA seq 623 aa AA seqDB search
MSSGLRAASLPAWKRHILDELRRRDRLQRQAFEEIILQYNKLLEKSDFHSVLADKLQVEK
YDLPSRHEISPGHDGARNDSHMQEIAQLRIKHQEELTELHKKRGELAQSVIDLKNQIQQK
DSEMQTNNTKIVEYLQKISELETECQDLRNKLQDLERANQTLKDEYDALQITFTALEEKL
RKTTEDNQELVTRWMAEKAQEANRLNAENEKDSRRRQAKLQKELAEAAKEPLPIEQDDDI
EVLADETSDPADETSPVRAVNRTASKRHSQPAGGLLDSITNIFGLSESPLLGHHSSDTAR
RRSLSSCPTPQDNVEAHPGASKEVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGLDR
RVKLWEVCGEKCELKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDHRLRHTL
TGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDLVCTEQCVMS
GHFDKKIRFWDIRTECVVQEMELLGRITSLDLNPERTELLTCSRDDLLKIIDLRVSAIKQ
TFSAQGFKCGSDWNRAVFSPDGNYVAAGSADGSLYIWNVLTGKVERVLSKHHSNSINAVA
WSPSGAHVVSVDKGNKAVLWSEF
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctggactcagggcagcgagcctccccgcctggaagcggcacatcctggacgaa
ttgaggcgacgggaccggctgcagagacaggcctttgaagagattatcttgcagtataac
aagctcctggagaagtcagatttccattcagtgctggctgacaagctacaagtggaaaaa
tatgacttgccaagccggcatgagatcagtccaggacatgatggtgcaaggaatgattct
cacatgcaagaaatagcccagcttagaattaagcatcaagaggagctgacagagctgcac
aagaaacgtggcgagttggcccagtctgtgattgacctgaaaaaccaaatacaacagaag
gacagtgagatgcaaacgaataatacaaagattgtagaatatttgcagaagatatctgaa
ctagagacagagtgccaggacctgcggaacaagctacaagatcttgaaagagccaatcag
actcttaaggatgagtatgatgcactccagattacctttactgcccttgaagaaaaactg
agaaaaactacggaagataaccaagagctggtaacacgctggatggcagagaaagctcaa
gaagctaatcggctcaatgcagaaaatgagaaagattccagaagacggcaagccaagctt
cagaaggaactagcagaagctgcaaaagagccgctgccaattgaacaggatgacgatatt
gaagtgctggcggatgaaacctctgaccctgctgatgagacatctccggtgcgcgctgtc
aatcgaacagccagtaagcgacactcccagccagctggaggccttctcgactctatcact
aatatatttggtctgtctgagtctccccttttgggacatcactcttctgatactgccagg
agacgctctttatcctcatgccccacccctcaagataatgtggaggcacatccaggcgca
agcaaagaggtgcgagtccctaccaccgctctgtgtgtctttgatgcgcacgatggggag
gtgaatgcggtgcagttcagccctggctcccggttactggcaacaggaggcttggaccgg
agagtcaaactctgggaagtttgcggagaaaagtgtgaacttaaaggctctctatctggc
agtaatgcagggattacaagcatagagtttgatagtgcgggctcttatttattagccgct
tcaaatgactttgccagtaggatctggactgtggatgatcatcggttacggcacacgctc
acggggcacagtggaaaagtcttgtcggccaaattcctattggacaatgcgcgcattgta
tctgggagtcacgacagaaccctcaaactgtgggacctgcgcagcaaagtctgtataaaa
acagtgtttgctggctccagctgcaatgatctggtctgcacagaacagtgtgtgatgagt
ggacacttcgacaagaaaattcgcttttgggatattagaactgagtgtgtggtacaggaa
atggaattgcttggtaggattacatctctagatctcaacccagagagaacagaactcctc
acctgttcacgagatgacctattgaagattattgatctcagagtcagtgctatcaaacag
actttcagtgctcaagggtttaaatgcgggtctgattggaacagagctgtattcagccct
gatggaaattatgtggcggctggctcagcagacgggtcactctatatttggaatgtgctt
actgggaaagtggagagggtcctctccaagcatcacagcaactcaatcaatgctgtggcg
tggtcaccatctggagcccatgtggtcagtgtggacaaaggaaacaaggctgtgctgtgg
tctgaattttga

DBGET integrated database retrieval system