KEGG   Podarcis muralis (common wall lizard): 114597957
Entry
114597957         CDS       T06059                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114597957 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmua03000]
    114597957 (MECOM)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    114597957 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_6 zf-C2H2_11 SET zf-BED PyrI_C zf-C2H2_8
Other DBs
NCBI-GeneID: 114597957
NCBI-ProteinID: XP_028587327
Position
5
AA seq 1282 aa
MRSKGRARKLAANNECVYESFPEIPLEETSENDGEPSTLSLSIHEQSSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPSEFELRESNIPGAGLGIWAKRKIEVGERFGPYVGEHSPSLKDP
GNGWEILDEYYNVKFCIDASQPDVGNWLKYIRFAGCYNQPNLVACQISDQIYYRVVKDIE
AGEELLLFMKTEDYLHDPMAPDIHEERQYRCEDCDQLFESKADLVDHQKFPCSTPHSAFS
MVDEEFQPKLDKENDLHDMHDIQECKECDQVFSDVQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFILCRPGLGANSPTPTHQHKGEVCHKSYTQFSNLCRHKRMHADC
RTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKSSMVNMNH
ANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLPNTDQS
IKSQSPLMTHPQTLPATQDILKALNKHPPNLSENKPVELQPERSSEERPHEKISDQSESS
DLDDVSTPSGSDLETTSGSDLESDIESDKEKCKENGKMFKDKVNSLQNLASVNNKKEYSN
HSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFF
PAFSQSMYPFPDRDLRPLPLKMEPQSPGEAKKILKGNSESPFDLTTKRKEEKPLTPITSK
PAAPSVTNQDQPLDLSMGSRSRASGTKQTEPRKNHVFGGKKGDIDLESRKSSDISLQHAR
PTPFFMDPIYRNVDLHCNQRCFTQELKTRCTIATQRGTQGVEKRKLTDPLEALKEKYLRP
SPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEAGDIMQSVPSMFNFRAPPSTLP
ENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRN
IHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDS
YFTEIRNFIGNSNHNNSEERINGSHFKDEKTLVTSQNSDLLEDEEAEDEVMLDEEDEESE
ITGGSVKEPAVSNICEEGDYEEANALEMNCKTSPGRYKEDEFNKTGLSALDHIRHFTDSL
KVRKAEESQFSEAELAAFSTSHLPEDLKQPLCRKSKSQAIAMMLSLSDKDSLHSAPHNSS
NVWHSMARVAAESSAIQSISHV
NT seq 3849 nt   +upstreamnt  +downstreamnt
atgcgatccaaaggcagagcgaggaaactggccgcaaataatgagtgtgtatatgaaagc
ttccctgagattcctttggaagaaacatctgaaaatgatggagaaccaagcactttgtca
ctcagtattcatgaacaatcatctccagcaacatcaagtgaagccttcacaccaaaggag
ggatctccttacaaagcaccaatatacattcctgatgacataccaattccatcagagttt
gagcttcgagaatcaaatattcctggagccggattagggatatgggccaaaaggaagatt
gaagtaggtgaaagatttggaccatatgtaggagaacatagcccaagtctgaaagatcct
ggcaatggatgggagatcttggatgagtattacaatgtgaaattctgcattgatgccagt
cagccagatgtaggaaactggctgaagtatatcagatttgctggatgctataatcagccc
aaccttgttgcatgtcaaataagtgatcagatatattacagagtggtgaaagacattgaa
gctggagaagagctccttctgttcatgaagactgaagactatttacacgatcctatggct
ccagacattcatgaggagcgtcagtatcggtgtgaagactgtgaccagctgtttgagtcc
aaagcagatctcgtggaccatcagaaattcccatgcagcacacctcactcagcgttttcg
atggtggatgaggaatttcagccaaagcttgacaaggagaatgacctccatgatatgcat
gacattcaagagtgcaaagaatgtgaccaagtgttctctgatgtgcaaagcttagaaaag
cacatgctatcgcacaccgaagagcgggagtacaagtgtgaccagtgccccaaagccttt
aactggaaatccaacttgatacgccaccagatgtcccatgacagtgggaagcattatgaa
tgcgaaaactgtgccaagcaggttttcacggaccccagcaacctccagagacacattcgt
tcgcagcacgttggggctcgtgcgcatgcttgtccagagtgtggtaaaacttttgccact
tcttcaggcctcaaacagcacaaacatatccacagcagtgtcaagccttttatattatgc
cgccctggcttgggagcaaactcaccaacaccaactcaccaacacaaaggtgaggtctgc
cataagtcctatactcagttttcaaacctttgccgtcataagcgtatgcatgctgattgc
agaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaat
aaacacaggagattttgtgagggcaagaaccattttgcggcaggaggattttttggccaa
ggcatatcacttcctggaaccccagctatggataaatcttccatggttaatatgaatcat
gcaaatccgggccttgctgactattttggtgccaataggcatcctgctggtcttaccttt
ccaacagctcctggattttcttttagcttccctggtctgtttccttcaggcttgtaccac
aggccacctttgatacctgctagttctcctgttaaaggactgccaaacacagaccaatca
atcaaaagtcaaagtcccctcatgacacatcctcagacactgccagctacccaggatatt
ttgaaggcactaaataagcacccacctaacctaagtgaaaataagccagtggagcttcaa
ccagaaaggtcctccgaagagaggccacatgaaaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacccccagtgggagtgacctggagaccacctctggctctgat
ctggaaagtgacattgaaagtgataaagagaaatgtaaagaaaatggtaaaatgttcaaa
gacaaagtaaactctctgcagaatttggcttccgtaaataataagaaagaatacagcaat
cattccatcttctcaccatctttagaggagcaaactgcggtgtcaggagctgtgaatgat
tctataaaggccattgcctctattgctgaaaaatactttggttcgacaggacttgtgggg
ctacaggacaaaaaggttggagccttaccttacccttccatgtttcccctcccatttttt
ccagcattctctcagtcaatgtacccatttcctgatagagacttgagaccgttacctttg
aaaatggaaccccaatcgccaggtgaagcaaagaagatcttaaagggaaactccgagtct
ccctttgaccttaccactaaacgtaaggaggagaaaccacttactcctataacctcaaaa
ccagcagctccatcagtgaccaaccaggaccagcctctagatttgagtatgggcagcaga
agtcgagctagtggtacaaaacagactgagcctcggaaaaaccatgtgtttggaggaaag
aaaggagatattgatcttgaatcaaggaagtcatcggacatctctttgcaacatgcaagg
ccaacacctttctttatggatcccatttacaggaacgtcgatctccactgcaatcaaagg
tgtttcactcaagaactcaaaacacgttgtaccatagcaacacaacgtggaactcaagga
gtagaaaaaagaaagctaactgacccacttgaagctttaaaagaaaagtacttgagacca
tctccgggattcctattccacccacaattccaattgcctgatcaaagaacttggatgtca
gctatagaaaacatggctgaaaagctagagagttttagtgccctgaaaccagaagccggt
gacatcatgcaatctgtcccttccatgttcaacttcagagcccctcccagcaccctgcca
gagaaccttctacgaaaaggcaaagagcgctatacctgcagatactgcggcaagatattt
ccaagatctgcaaatcttacccgtcacctgagaacacacactggagaacagccttacaga
tgcaaatactgtgacaggtcttttagtatatcgtctaacctgcagagacatgttcgtaac
atccataataaggagaagcccttcaaatgtcacttatgtgaccggtgctttggccaacaa
accaacttagatagacatctcaaaaaacacgagaatggcaacatgtctggtactgctacg
tcttcacctcattctgaacttgaaagcacaggtgctatcctagatgacaaagaagactca
tactttactgaaattcgtaatttcattgggaatagcaaccacaacaactcagaagaaaga
attaatggaagtcactttaaggatgaaaagactctggtgacaagccagaactcagacttg
ttggaagatgaagaagcagaagatgaagtaatgttggatgaagaagatgaagaaagtgag
ataacaggggggtctgttaaagaaccagctgtaagcaacatatgtgaagagggtgactat
gaagaagcaaatgctttggaaatgaattgcaagacttctcctggcaggtataaggaagat
gagtttaataaaactggactttctgcgttggaccatataaggcacttcactgatagcctc
aaagtgaggaaagcagaagaaagccagttcagtgaagctgaactggcagcgtttagcacc
tcccatctgccagaagacttaaagcagccattgtgtcgcaagtccaaatcccaggccatt
gctatgatgctttcactctccgacaaggactctctccactctgcaccccacaattcatcc
aatgtgtggcacagtatggcaagagttgctgcagaatccagtgccatccagtccattagt
catgtatga

DBGET integrated database retrieval system