KEGG   Podarcis muralis (common wall lizard): 114598486Help
Entry
114598486         CDS       T06059                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04068  FoxO signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114598486 (FASLG)
   04068 FoxO signaling pathway
    114598486 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114598486 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114598486 (FASLG)
   04217 Necroptosis
    114598486 (FASLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114598486 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmua04147]
    114598486 (FASLG)
   04052 Cytokines and growth factors [BR:pmua04052]
    114598486 (FASLG)
   04090 CD molecules [BR:pmua04090]
    114598486 (FASLG)
Exosome [BR:pmua04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   114598486 (FASLG)
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Tumor necrosis fators
   114598486 (FASLG)
CD molecules [BR:pmua04090]
 Proteins
  114598486 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 114598486
NCBI-ProteinID: XP_028588019
Position
6
AA seq 267 aa AA seqDB search
MALPAMQQNPHCIYPQVFWTSSSGVSNSECAPSGLCPIRFAPHQDIRPALPVPETKRKKQ
SKKDGTRLCFLVVSLLTLLALTGVGLAMFQIFRLQQELDALRELSCSGQVPQSPEMLKGF
LNGTAEKEVKRRAHLTGKANQRSLPLEWESTYGHAFISGVQYENRGLVIDEAGLYFVYSK
VFFRGGACTPQPLDHVVFKRNPSYPDIQVLMEDRKMSYCVARHMWGRSSYLGALFNLSRQ
DSLYVSVSEVTLVNPEESKTFFGLYML
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctctccccgccatgcagcagaacccgcactgcatttatccccaggtcttctggaca
agcagcagtggagtttccaactctgagtgtgccccttcaggactgtgtcccatcaggttt
gcgccccaccaggacatccgccctgctctgcctgtgccagagaccaaaaggaaaaagcag
agcaaaaaggatggcacacgcctgtgtttcctggtggtttctctgctgacccttctggcc
ctcactggggttgggcttgcaatgtttcagatcttccgtctgcagcaggaactagatgct
ctgagagagctttcctgctctgggcaggtgcctcaatctcctgagatgctcaaaggattt
ctgaatggaacagcggaaaaggaagtcaagaggagagcacacttgacaggcaaagcaaac
cagcgatcgctcccactggaatgggagagtacctatggacatgccttcatttctggtgtt
cagtatgaaaacaggggtttggtgatcgatgaagctggcctctactttgtgtactccaaa
gtgttcttccggggtggggcctgcaccccccagcctcttgatcatgtggttttcaaaaga
aacccatcgtatcctgatatccaggtgctgatggaggaccgaaagatgagctactgtgtg
gccaggcacatgtggggcagaagcagctatttgggtgctttgttcaacctttccaggcag
gacagcctgtatgtgagtgtctcagaagtcacactggtgaatcctgaggagtcaaaaacc
ttctttggcttatatatgctttag

DBGET integrated database retrieval system