KEGG   Podarcis muralis (common wall lizard): 114602206Help
Entry
114602206         CDS       T06059                                 

Gene name
HSD17B2
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 2 isoform X1
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00140  Steroid hormone biosynthesis
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    114602206 (HSD17B2)
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     114602206 (HSD17B2)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     114602206 (HSD17B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Epimerase
Motif
Other DBs
NCBI-GeneID: 114602206
NCBI-ProteinID: XP_028595963
Position
8
AA seq 391 aa AA seqDB search
MHHSEADSSLLIYMGAVVLYGGTILYRAKKNCVEKATSFSWGLLLLLASGVLCFATLRSY
LGLSLFSLMCFLFCIYTSDQALLPVDHKAVLITGSDSGIGHALAKYLDSLGFTVFATVLN
ERGAGAEKLRQSCSDRLSVLQLDITNSVQIKEAYLEVRRKLQGADLWGVINNAGVLGLPG
DGELLPMQSYKQCMDVNFFGPVELSKAFLPLLRKSKGRLINISSMAGGIPMPGFAAYGAS
KAALSMFSGVMRQELSKWGIKVSVLHPSGFKTCIQGTPEIWNKEERTLLENLMPDVKQDY
GEEYILKMKMALNAMQFLSMSDLSPVLCDVLHALLAERPCGLYTPGKNAYKYLLIFCYSP
LWFYDFCIRKMFSTSDMPSALRAAEKANKNL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcaccactctgaagctgacagctccctgttgatctacatgggtgcagtggtgctctat
ggagggacgatcctttaccgagccaaaaagaactgtgtggagaaggcaacctccttttcc
tggggtctcctcttgctccttgcttcaggagtcctgtgtttcgccacgctgagaagttac
ctgggcttgagtttgttctcgctgatgtgcttcctcttctgcatttacacatctgatcaa
gccctgctccctgtggaccacaaagcagtactcatcacaggaagcgatagtggcattgga
catgcattggcgaagtaccttgacagtttaggattcaccgtgtttgccaccgttctgaat
gagagaggggctggtgcagaaaaactgaggcagtcctgctccgatagactttctgttctg
caactagacatcactaattcggtgcagattaaagaagcgtaccttgaagtaagaaggaag
ttgcaaggtgcagatctctggggtgtcatcaacaatgctggggtcctgggtctcccggga
gatggggaactgctccctatgcaatcttacaagcagtgcatggatgtcaatttcttcggt
cccgttgaactgtcaaaagctttcttgccattgctccgcaagtccaaaggaaggcttatt
aacatttcaagcatggcaggaggtatccccatgccaggcttcgctgcctacggtgcatcc
aaagcagccctatccatgttttctggagtcatgaggcaagagctctccaaatggggcatt
aaagtatctgtgctgcatccatcaggcttcaagacatgtatccagggaactccagagatc
tggaataaggaagaacgcacccttcttgagaatctcatgcctgatgtgaagcaagattat
ggtgaagaatacatcctcaagatgaagatggctctcaatgccatgcaatttctttccatg
tcagatctctctcccgtgctttgtgatgttttacacgcattattggcagagcgcccatgt
ggtttatacactccaggcaagaatgcttacaaataccttctcatcttctgctattctcct
ctctggttttatgacttttgcataaggaaaatgttcagcacctcagacatgcccagcgct
ctcagagcagcagagaaagcaaacaagaacttgtag

DBGET integrated database retrieval system