KEGG   Podarcis muralis (common wall lizard): 114603096Help
Entry
114603096         CDS       T06059                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114603096
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pmua04030]
    114603096
G protein-coupled receptors [BR:pmua04030]
 Rhodopsin family
  Lipid
   Leukotriene
    114603096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 114603096
NCBI-ProteinID: XP_028597675
Position
8
AA seq 336 aa AA seqDB search
MDPSEESNDLLPLSIARHLVCTVLSLSFIVGIPGNSFVIWTICGRMAQRPPTVMLILHLA
IADLLVLVTLPIWIYSFANTWLFGLVACKALTFVVYFSMYASIFLIMALSFERFMAVFYP
FAVQCWKKKMTTRMLVFAIWFLAIAFGAVIIPFRETNNTEAGLQCADFSYDSNAQMIACL
LLETLVGFVVPFAFISICYVLVGRRIRNMTSPSKQRSAKLIASIVVAFCLCWLPHHIFNL
ISIASALMEESYPGTSEALEKISAVGANITGSLVFVSSCINPLLYAFAARNFQSSVRFTR
LSRLFEQMSPSERTETVKEAPNTNGNEESLTSTEMI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatccctctgaagaaagcaatgatctcctgcctttgtccattgcaaggcatttggtt
tgcacagtgctgagtttgtcattcatcgtcgggatccctgggaactcctttgtcatttgg
accatctgtggcagaatggcccaaaggcctccgacggtcatgctgatcctacatctggcc
atcgctgacctcctggttcttgtcaccttgccaatctggatctactccttcgccaacacc
tggctctttgggctcgttgcttgcaaagccctgacattcgtcgtttatttcagcatgtac
gcaagcatcttcctgatcatggccttgagctttgagcggttcatggctgtcttttacccc
tttgctgtccaatgctggaagaagaagatgaccaccaggatgttggtctttgccatatgg
ttcctcgccattgcctttggagccgtcatcatcccgtttcgggaaaccaacaacacagag
gcaggtcttcagtgcgcagatttcagttatgatagtaatgctcaaatgattgcctgtctc
ttgctggagactcttgtgggctttgtcgtgccctttgccttcatctccatctgttatgtg
ctggtcggcagaagaatcagaaacatgacttctccatcaaagcaacgctctgcaaagctg
atcgcttcaatagttgtggccttttgtctctgctggctgccccatcacatctttaacttg
ataagtattgcttcagctctgatggaggagtcctatccagggacatctgaagctctggag
aagatttcagcagtgggggccaacatcacaggctcgcttgtcttcgtgagcagctgcatc
aaccctctcctttacgcctttgctgccaggaacttccaaagcagcgtgaggtttaccagg
ctatctagactgtttgaacagatgagcccttcagagaggacggaaactgtgaaagaggca
ccaaacacaaacgggaacgaggagagtttgacaagcacagagatgatctaa

DBGET integrated database retrieval system