KEGG   Podarcis muralis (common wall lizard): 114603360Help
Entry
114603360         CDS       T06059                                 

Gene name
CD79A
Definition
(RefSeq) B-cell antigen receptor complex-associated protein alpha chain isoform X1
  KO
K06506  CD79A antigen
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmua04090]
    114603360 (CD79A)
CD molecules [BR:pmua04090]
 Proteins
  114603360 (CD79A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig V-set I-set ITAM Ig_2 Ig_6
Motif
Other DBs
NCBI-GeneID: 114603360
NCBI-ProteinID: XP_028598113
Position
8
AA seq 277 aa AA seqDB search
MKGGPKELCFLVLLGLFTGYACGNQTTVDKSISPSDTLNASSSGTTEATLSPTTEKKHPK
TAPLPTPVGYVSMTVEAGRPSYITTEGSSATLECKFKAPSGAKVIWKKTCSSNCSESFAV
NETDTRKITEDISQGLSTLSFHSVQREDTAMYYCCVSAPSAGQRQSCGTYLWVRRPRPAS
FLNMTEGVKNKIITAEGFLLLICAIGPGLFLLFRKRWENERLLQAKKKAYEEENIYEGLN
LDDCSMYEDISRGLQATYQDIGNVKVIDLQLEKPEKP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggtccaaaagagctgtgtttcctggttctactgggtctctttacaggttat
gcttgtgggaaccagaccacagttgacaagtccatttcaccatcagacacactaaatgcc
agcagctctggaacaacagaagccactctgtcccctacgactgagaaaaaacaccccaaa
acagcccccctgcctacaccagtgggctatgtgtccatgacggtggaggctggacgcccc
tcttacataaccaccgaagggtcttctgcaactctggagtgcaagttcaaggcccccagt
ggggccaaagtcatttggaaaaagacttgctcctccaactgcagtgaaagctttgctgtc
aacgagactgacacccggaagatcacggaagacatttctcaagggttgtcaacgctcagc
ttccattcagtccaaagggaagacacagccatgtactattgctgtgtgtctgctccatcg
gccggccaacgccagtcttgtggcacgtacctctgggtccggaggcctcgaccagcctct
ttcctgaacatgacagaaggtgtcaaaaataagatcatcacagctgagggtttcctgcta
ctcatctgtgccattggtcctggtctttttttgctcttcaggaagagatgggaaaacgag
cgccttttacaagccaagaagaaggcttatgaagaggagaacatatatgagggactgaat
ctggatgactgttccatgtatgaggacatttcacgggggctgcaggccacctaccaggac
atagggaacgtgaaagtgattgatctgcagctggagaagccagagaaaccgtga

DBGET integrated database retrieval system