KEGG   Podarcis muralis (common wall lizard): 114603815
Entry
114603815         CDS       T06059                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmua01009]
    114603815 (AKAP5)
Protein phosphatases and associated proteins [BR:pmua01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     114603815 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 114603815
NCBI-ProteinID: XP_028598969
Position
1
AA seq 482 aa
MEDATKEIQTESMQEPEASNAEKPFLPHESPAQKASAICFKKRKKPYATEKDEDRESVIR
KATNQLSNSGQSQMEASDLSWTSGGAWLSFKRLVTLRRRSKSALKKQAQSGSRVQLEANV
ENSGAKERTSSNHKIPCLRFCRSKKSCQPEITEEGDHGEKASEGASILDNKRNSEPESVS
VEGPLNADQSPSGALENEGNRGVVNNSEEVAPARREDAFSEMSPGPDQYTDFTAQSEIIH
SETVLETEQEKQLFQLHHGSLYGEPEEGRNERFDFEGEVGSLLAQDLPESQPNVLEGEDS
KNSPAKEAELEQSGEDAVPEMDGAKEGDSVEVMLHCSQPVSEDEASQEPNCPVQEAESDE
NKLAMPGAGIVIMITEAEAFQEEEEEELSYSCETFSFPQASKQKAKKKTSKGPDSRSGRE
GKTCPQDQPPLGASDQEPWASEQYEVLLIETAASLVKAAIQSSIEQLVNEMALEQNKQNS
FL
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggaggatgcaacgaaagaaattcagacagagagtatgcaagaaccagaagcctcaaat
gcggaaaagcctttccttccacacgagagcccggcccaaaaggcctccgcgatttgcttt
aagaaaaggaagaagccctacgcaacagagaaagacgaggatcgtgaatctgtaatccga
aaggctacaaaccagctctccaactctggccaaagtcaaatggaggcttcagatctatcg
tggacgtccggaggggcctggttgtccttcaagcggcttgtgacactgaggaggaggtcc
aaatccgctttgaagaaacaagcgcagtctggttcccgtgtgcagctggaggcgaatgtg
gaaaattctggcgcaaaggagcgcaccagctcaaaccataaaattccctgcctaaggttc
tgtagaagcaagaagtcctgccagcctgaaataacagaggagggggatcacggcgagaaa
gccagcgaaggggcgagcattctggataacaaaaggaacagtgaaccggagtctgtgtct
gtggaaggtcctctgaacgctgaccagtcccccagcggtgcccttgaaaacgagggcaac
aggggggttgtaaacaactctgaagaggtggctccagccaggcgagaggacgctttttca
gagatgagtcccggtcccgaccaatacacagactttacggctcagtcagaaatcatccac
tccgaaacagtcctggaaacagaacaggagaagcaactcttccagctgcatcacggaagc
ctctatggggaacctgaagaagggagaaacgagaggtttgattttgagggagaggtgggc
tcactgcttgcccaggacctgccagaaagccaacccaacgtcttggaaggagaagactcc
aagaactcgcctgccaaagaggctgagttggaacaatctggggaggatgctgtgccggag
atggacggtgccaaggaaggcgattcggttgaagtgatgctgcattgcagtcagcctgtg
tccgaagacgaggcttcacaggagccaaattgtcctgtccaggaagcggaatccgacgaa
aacaagcttgcgatgcctggggcgggcattgtgatcatgatcacagaagcggaggccttc
caggaggaagaggaagaggaactcagctatagctgcgaaacgttttcctttccgcaagcc
agcaaacagaaagcaaagaagaagaccagcaaaggccccgattccaggtcagggagggaa
ggcaagacgtgtccgcaggaccagccgcctttgggtgccagtgaccaggagccctgggct
tcagaacaatacgaggtgcttctgattgaaacggccgcctcacttgtgaaggcggccatc
cagtcgtccatcgagcagcttgtgaatgagatggctctggagcagaataaacaaaacagt
tttctatga

DBGET integrated database retrieval system