KEGG   Podarcis muralis (common wall lizard): 114604018Help
Entry
114604018         CDS       T06059                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua01100  Metabolic pathways
pmua04270  Vascular smooth muscle contraction
pmua04540  Gap junction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114604018 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114604018 (GUCY1B1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114604018 (GUCY1B1)
Enzymes [BR:pmua01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114604018 (GUCY1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 114604018
NCBI-ProteinID: XP_028599536
Position
9
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKREAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHIQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRYLVVTQCGNAIYRVL
PQLQPGYCNLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDILTDSRRNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGRINVSEYTYRCLMAPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKCTETEDVTHDAN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggattcgtcaatcacgctctggagcttctggtgatccggaattacggccccgag
gtctgggaggacatcaagcgggaggcacaattggatgaagaagggcagtttctagttaga
attatttatgatgattcaaaaacatacgatctggttgctgcggcaagcaaagtccttaac
cttaacgctggagaaatccttcagatgtttgggaagatgttttttgtgttttgtcaagaa
tctggttatgacaccatcttgcgtgtgctgggctccaatgttagagaatttttgcagaac
cttgatgctcttcatgaccaccttgctacaatatacccaggtatgcgggccccttccttt
agatgtactgatgcagaaaaggggaagggactcattctgcattactattccgagagagaa
ggactccaagacattgtaattggaatcatcaaaacagttgctcaacaaattcacggcaca
gaaatagatatgaaggttattcaacagagaaatgaagagtgtgaccacattcagttttta
attgaagagaaggagtctaaggaagaagatttttatgaagacctggacagatttgaagag
aatggcactcaagagtctcgcatcagtccttatactttttgcaaagctttccctttccat
attatatttgatagatatctagttgtcacccagtgtggcaatgcaatatacagagtcctt
ccacagctccagcccgggtattgcaatcttttgtcagtgttttcgttggttcggcctcat
attgatattagtttccatggaatcctctcacatataaacacagtctttgtgctgaggagc
aaggaagggctgttggatgtggaaaagttagagtgcgaagatgaattaactggaacagaa
attagctgcttacgccttaagggtcaaatgatctacctaccagaagcagatagtattctc
tttctttgttctccaagtgtgatgaatttggatgacttaaccagaagagggctatacctg
agtgacattccactgcatgatgctacccgtgatttggtccttttgggagagcagttcaga
gaggaatacaagctgactcaagagctggagatactaacagacaggcttcagcacacatta
agagcactggaagatgagaagaaaaagacagacaccttgctgtattctgtccttcctcca
tctgtggccaatgagctgaggcacaagcgccctgtgccagcaaagcgctatgataatgtg
accatactttttagtggcattgttgggtttaatgccttctgtagtaaacatgcctctgga
gagggagccatgaaaattgtcaacctcttaaatgacctttacacaagatttgatatcctg
actgattcacgaaggaacccctttgtttataaggttgagacagttggagacaagtatatg
acagtaagtggcttgccagagccatgcattcaccatgcgcgttctatctgccacttagca
ttggatatgatggaaattgccggacaggttcaagttgatggagagtctgtacagataaca
ataggcatccacacaggagaagtggtcacaggtgtcattggccaaaggatgccccgttac
tgtctttttggaaacactgttaatctaacaagcagaacagaaaccactggagagaaagga
agaatcaatgtctctgaatatacttacaggtgtctaatggctcctgaaaattcagaccca
caattccatctggaacacagaggtcccgtttccatgaagggtaaaaaagaaccaatgcaa
gtttggtttttgtccagaaagtgcacagagacagaggatgtaacgcacgatgctaactga

DBGET integrated database retrieval system