KEGG   Podarcis muralis (common wall lizard): 114604152Help
Entry
114604152         CDS       T06059                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00020  Citrate cycle (TCA cycle)
pmua00640  Propanoate metabolism
pmua01100  Metabolic pathways
pmua01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114604152
   00640 Propanoate metabolism
    114604152
Enzymes [BR:pmua01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114604152
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114604152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA DUF742
Motif
Other DBs
NCBI-GeneID: 114604152
NCBI-ProteinID: XP_028599839
Position
9
AA seq 176 aa AA seqDB search
MQAQPKLFISCHKFRLWPAIRVEIGGDPFSGMNFIDCLDVFLSDLQTEGIILIGETSGSA
KKDAATILKEVNSGLNAKPLVSVIAGLTAPPSRIMSHAATIIDVGKGQAKEKITALLSVR
AVIRVILTHLDSVRYSELQQWKTFRTVRIPPHLQNVSNALSDVQAVRAIASGNTET
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcacagccaaagctgttcatcagctgccataagtttcgattgtggccagctatt
cgggttgaaattggaggagatccattcagtggaatgaattttattgattgccttgatgtg
ttcctgagtgatcttcaaacagaggggattatattgattggagagaccagtggcagtgcc
aaaaaggatgctgccactatcttaaaggaagttaattctggcctgaatgccaagccacta
gtttcagtcatagctggtttgactgctcctccaagcaggataatgagtcatgctgcgaca
atcattgatgttggaaaaggtcaagctaaagagaaaataactgctcttctaagtgtcaga
gcagtcatcagggtgattcttactcacctggacagtgtcaggtacagtgaattacagcag
tggaaaacatttagaacagtaagaattcccccccatctccaaaatgtgagtaacgctctt
tccgatgttcaggctgtgagggctattgcttctggaaacactgaaacatga

DBGET integrated database retrieval system