KEGG   Podarcis muralis (common wall lizard): 114604270
Entry
114604270         CDS       T06059                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua00240  Pyrimidine metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114604270
   00240 Pyrimidine metabolism
    114604270
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     114604270
SSDB
Motif
Pfam: dNK AAA_28 AAA_33 Thymidylate_kin AAA_18 DUF5324
Other DBs
NCBI-GeneID: 114604270
NCBI-ProteinID: XP_028600077
Position
9
AA seq 256 aa
MATPPKRSRAETAIKKIAIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCNVQNCPDD
KEELTSSQKSGGNLLEMMYEKPERWSFTFQTYACLSRIRAQLKSFEGKLKEAENPVVFFE
RSVYSDRYIFASNLYETDCMNETEWTIYQDWHNWMNQQFGSSLRLDGIIYLRATPEKCLN
RIYVRGRDEEQGIPMEYLEKLHYKHESWLQHRTLRTDFEYLQDVPVLTLDVNEDFKGNKD
RHEDMIEKVKEFLSTL
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcaaccccacctaagcggagccgggccgagaccgccatcaagaagatcgccatagaa
ggcaacatagctgccgggaagtctacttttgtgaatattctcaaacaagccagtgaagat
tgggaagttgttccagagccagtagcaaggtggtgcaatgttcagaattgccctgatgac
aaagaggagcttacttcctctcaaaagagtggtggcaacttgcttgagatgatgtatgag
aagccagagagatggtccttcactttccagacttatgcttgcctgagcagaatccgggct
caacttaaatcttttgaagggaaactcaaagaagctgagaaccccgtcgtcttctttgag
agatctgtttacagtgacaggtacatttttgcgtctaatttatatgagacggactgcatg
aatgaaaccgagtggactatttaccaagactggcataactggatgaaccagcagtttggc
tcaagtcttcggctggatggcattatttatctccgagctacccctgagaaatgcttgaat
aggatttatgtgcgtgggagggatgaagaacaaggcattcctatggaatatctggaaaaa
cttcattacaaacatgaaagctggctccagcacagaacattgcgaacggattttgaatac
ctgcaagacgtacctgttctaacactggacgtaaatgaagacttcaaaggcaacaaagac
aggcatgaagatatgattgaaaaggtcaaagaatttctgagcactttgtag

DBGET integrated database retrieval system