KEGG   Podarcis muralis (common wall lizard): 114604687Help
Entry
114604687         CDS       T06059                                 

Definition
(RefSeq) histamine N-methyltransferase-like isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00340  Histidine metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    114604687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmua04147]
    114604687
Enzymes [BR:pmua01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     114604687
Exosome [BR:pmua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114604687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_25 Methyltransf_34
Motif
Other DBs
NCBI-GeneID: 114604687
NCBI-ProteinID: XP_028600893
Position
1
AA seq 186 aa AA seqDB search
MPICCFSWYSAMTMRSLLSDHSHYVESFRLFLENSTEHQCMLEFIQKKLPGILSSIGSGK
STINILSVGGGAGEVDLQILAEVRAKYPGVVICNDVVEPSAEQISAYKERVAKTENLENI
KFSWHKETSLEYESRMKASKEVKKWNFIHMIQMLYYVKDIPATIRFFHSLLEPGAKLLII
LVSGKY
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccgatatgctgctttagttggtattctgccatgactatgagaagcttgctttctgac
catagccactatgtcgaatcctttcgtctgttccttgagaattcgacggagcatcaatgc
atgctggaattcattcagaagaagctgccaggcatattatcaagtataggcagtggaaaa
tctacaatcaatattctaagtgttggtggtggggcaggagaagttgaccttcagattctt
gcagaagtacgggctaaatatcctggagtcgtcatttgtaacgatgtggtagaaccaagt
gctgaacaaataagtgcctacaaagaacgagtagcaaagacagaaaaccttgagaacata
aagttttcttggcacaaggagacttcgctggaatatgaaagtcgaatgaaggccagcaaa
gaggtgaagaaatggaacttcatccacatgatccagatgctgtattatgtaaaagacatc
ccagctactatcaggtttttccacagcctcttggaacctggggccaagctccttattatt
cttgtttcaggtaagtactga

DBGET integrated database retrieval system