KEGG   Podarcis muralis (common wall lizard): 114605096Help
Entry
114605096         CDS       T06059                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114605096 (CACNA1I)
   04020 Calcium signaling pathway
    114605096 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmua04040]
    114605096 (CACNA1I)
Ion channels [BR:pmua04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114605096 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 114605096
NCBI-ProteinID: XP_028601745
Position
10
AA seq 2185 aa AA seqDB search
MAEHGSHPSSTRQSGNPPTRNPTLCSLEHVDPGMSEQPTLLEQPPPSPDLGDEDDDGDME
PPLDPDVPYPDLAPVVFFCLKQTTSPRSWCIKMVCNPWFEFVSMMVILLNCVTLGMYQPC
DDMDCLSNRCKILQVFDDFIFIFFAMEMVFKMVALGIFGKKCYLGDTWNRLDFFIVMAGM
VEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFI
FGIIGVQLWAGLLRNRCFMEENLTIQGNITLPLYYQPEEDDEKPFICSLSGDNGIMGCHE
IPPLKERGHVCCLDKDDYYYYTSVRQEFNVSGMCVNWNQYYNECRTGNTNPHKGAINFDN
IGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFS
ETKQREHQLMQEQRARYLSSSTVASYMEPGDCYEEIFQYVCHIVRKAKRRTLGFYNSLQD
RRLGRTEPSAAKRSMNGKDQRQYRRCRKHNCVDYVPQGLGQPIAMTLTSDPSNCPRCHKA
QREAARRLSVLESADSDQEEGRGPSEEEGDGRKESTGTTDLEKEEEDGEEGGQLALWSDV
WQEVRVKLRGIVESKYFNRGIMIAILVNTISMGIEHHEQPEELTNILEICNVVFTSMFAL
EMILKLAAFGLFDYLRNPYNIYDSIIVIISIWEIIGQADGGLSVLRTFRLLRVLKLVRFM
PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFD
SLLWAIVTVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGF
QAEVFDFIFPMQGDANRSYSDDDQSSSNNEEFDKFQDGSDPKLCAIPMTPNGHLDPSLPC
LNQPGAAAGIPNPSRNTLQPDQVLMALESRKSSVMSLSSSRSSHYGAWSRTGGWGSRRSS
WNSLARGHSLKHKPPSAEHESLLSGERHRASEGEQEGLVRVHHHRRTLSLDTKGSSELVE
LAPTVLSNHRPLRKMGVTTGPSEHQNCNGKMPNIAKDMFPEMNNRKDHGEDEEEIDYSLC
FRIKKMIEAYKPDWCELREDWAIYLFSPQNRFRILCQTIIAHKLFDYIVLAFIFLNCITI
ALERPQIEQRSTERIFLTVSNYIFTAIFVAEMTLKVVSLGLYFGEQAYLRSSWNILDGFL
VFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIG
NIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYKWVHHKYNFDNLG
QALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFV
GVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCSVRLLIHSVCTSH
YLDIFITFIICLNVVTMSLEHYNQPMSLETALKYCNYMFTTVFVLEAVLKLVAFGLRRFF
KDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRA
LLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLICNDENPCEGMSRHATFENFGMA
FLTLFQVSTGDNWNGIMKDTLRECTHDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVA
VLMKHLDDSNKEAQEDAEMDAEIELEMAHGLCSRNCGSPSAGHDGGGGRLDPGGQLCMAC
YSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCNHDKQEVQLAEM
EGLSLNSDKSSILLGDDGDNNSVDQPSPKEEEAKDGEDSPNSEECLFPLTNMEASPTPES
YLCEVEKISFSPVQSWLKNESNPGPPTPFSPDPSNPLLPLRAEFFVPAVSANPPSQEKAS
CPESLPKISLQASWASLQSPGVHCSLIHQTTESDTSLEDCRSNSSEGSLQTTLEDSLNLS
DSPQCTLDLPVALCPVPATATKKALVAPLSPASRRQSLRGRGIFTLRNISRHQRSHSSGG
STSPGCTYHDSMDPSDEEGAGSSLRGGGNNSEQSETLSSLSLTSLFSPPPPPQGLALVKK
CNSTSSLHANPSSRGSAATDSKQFYSVDPRGFLSMPSWVTDFCKNSPSPREGNVPEGSDR
IETAGHSSPIPSELQLGSGVSKRNR
NT seq 6558 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacatggctcccacccctcctctacccggcagtcggggaacccacccactcgc
aatcccactctgtgctctctggaacatgtggatccgggaatgagtgagcaaccaaccctg
ctggagcaaccaccaccatccccagacctgggtgacgaagatgatgatggtgacatggag
cctccgctggacccagatgtgccctatcctgatttggcccccgtggttttcttctgcctg
aaacagaccaccagccctcgcagttggtgcatcaagatggtgtgcaatccttggtttgag
tttgtcagtatgatggtgatcctactgaattgtgtgacccttgggatgtaccagccttgt
gatgatatggactgcctctccaacagatgtaaaattttgcaggtttttgacgatttcatc
ttcattttctttgctatggagatggtttttaaaatggtggccttggggatctttggcaag
aaatgctaccttggagacacttggaaccgcctggatttcttcattgttatggctgggatg
gtggaatattctctggatctccagaatatcaacctgtctgcaatccgcactgtgcgcgtc
ctgaggcccctcaaagccatcaaccgtgtgcctagcatgcgaatcctggtgaatttgctt
ttggacaccttgcctatgctggggaacgttctgcttctctgcttcttcgtcttcttcatc
tttggcatcattggggtgcagctatgggctggtctgctgagaaaccgctgtttcatggaa
gagaacttgacaatacaaggtaacatcacccttcctctctattatcaacctgaggaggac
gatgaaaagcccttcatctgttcactgtcaggagataatggaatcatgggctgtcacgag
attcccccactgaaggagcgaggccacgtttgctgtttggacaaggatgactattactac
tacacctctgtcagacaggagttcaacgtcagcggcatgtgtgtcaactggaaccagtat
tacaatgagtgtcgcacgggcaataccaacccacacaaaggggctatcaactttgataat
attggctatgcatggattgttatatttcaggtgattacactggaagggtgggtggagatt
atgtactacgtgatggacgctcattcattctacaacttcatctacttcatcttgctgatc
attgtgggctcattcttcatgatcaatctatgcctggtggtcattgctacacagttttcg
gagaccaagcagcgagagcaccaactgatgcaggagcagcgagcacggtacctgtcctcc
agcaccgtggccagctacatggaaccaggagactgctatgaagaaatcttccaatacgtc
tgccatattgtacgcaaggccaagcgccgcacccttggcttctacaacagcctgcaggat
cggcgcctgggccgaacggagccgagcgctgccaagaggagcatgaatgggaaagaccag
aggcaatacagacgttgccgaaagcacaactgtgttgattatgtcccacaaggccttggc
caaccgattgccatgactctgacatctgaccccagcaactgcccaagatgtcacaaggcc
cagcgggaagcagcccggagactctccgtgcttgagagtgccgattcagatcaggaagag
ggaagaggacccagtgaagaggagggagatggaagaaaagaaagcaccgggactacagac
ctggagaaagaggaggaggatggagaggaaggtggacagctggctctctggagtgacgtg
tggcaagaagtcagggttaaactgaggggaattgtggagagcaaatacttcaaccgtggg
atcatgatcgccatccttgtgaacaccatcagcatgggcattgagcaccatgaacagcca
gaagagctgactaatattttggaaatctgcaatgttgtgtttaccagcatgtttgcccta
gagatgatcttgaaacttgctgcctttggcctctttgattatcttcgcaatccttacaac
atctatgacagcatcatcgtcatcatcagcatctgggagatcataggccaggctgatggt
ggcctgtccgtgttgaggacattccggctactgagggtgttgaagctggtgaggttcatg
cctgccttgcggcgtcagctggtggtgctcatgaagaccatggacaatgtcgctaccttc
tgcatgctcctcatgctgtttatctttatattcagcatcctgggaatgcacatctttggg
tgtaaattcagcctcaggactgacacaggagacacagtccctgaccggaagaactttgac
tccctactttgggctattgtcacagtgttccagatcttgactcaggaggactggaatgtt
gtgctctacaatggcatggcctcaacttcaccatgggcatctctttactttgtggctctc
atgacatttggcaattatgttctgttcaatctgctggtggccatcttggtggagggattc
caggccgaggtctttgattttattttcccaatgcagggtgatgctaaccggtcatattca
gatgacgatcagagttcatcaaacaatgaggagtttgacaaattccaagatggctcggat
ccaaagctttgtgcaattcccatgaccccaaatggacatcttgaccccagccttccgtgt
ctcaaccagcctggagcagctgctggaattcccaacccttcccgcaatactctgcagcca
gaccaagtcctcatggccctcgaatccaggaaaagcagtgtgatgtctctgtctagctct
cgtagttctcattacggtgcctggagccggactgggggctgggggagccgccgctccagc
tggaacagccttgcccggggacacagcctcaagcacaagcctccttcagctgagcatgag
tccctcttatccggggaacgacacagggcatcagagggtgaacaggaagggctagtaaga
gttcaccaccatcggcgaaccctctccttggacaccaaaggctcctctgaactggtggag
ttggcacccacagtcctatccaatcacaggcctttgcggaaaatgggtgtgaccacaggg
cccagtgagcaccagaactgcaatggcaaaatgcccaacattgctaaggatatgttccca
gaaatgaacaaccgcaaagaccatggagaagacgaggaggagatagactatagcctgtgt
ttccgtatcaaaaagatgatagaggcctacaagccagactggtgtgagttgcgtgaagac
tgggccatctaccttttctcaccacaaaacagatttcgtatcctctgtcaaactatcatc
gcccataagctgtttgattacattgtcctggccttcattttcctgaactgcatcactatt
gccctggagagaccacagattgaacagagaagcacagagagaatcttccttacggtatcc
aattacatcttcacagcgatcttcgttgctgagatgacactgaaagtagtctcccttggc
ctatattttggggagcaggcctatctccgcagtagctggaatatcctggatggcttcttg
gtgttcgtatccatcattgatattgtggtttcggtagcctctgctggtggagccaaaatt
ctgggggtgctgcgagtcctccggctgctgcgtactttacgccctcttagggttataagt
cgtgcaccgggcctgaagcttgtggtcgagacactcatttcatcactcaagcccattgga
aacatcgtcctcatttgctgtgctttcttcatcatcttcggcattcttggggtgcagctg
ttcaaggggaagttctaccactgtctgggcgtggacacccgaaacatcaccaataggtct
gactgcatggctgccaattacaagtgggtccatcacaaatacaacttcgacaatctgggc
caggctttgatgtcactctttgtactggcttccaaagatggctgggtcaacattatgtac
aatggactggatgctgtggctgttgatcagcagccagtgaccaacaacaacccttggatg
ctcctttacttcatttctttcttgctcatcgtcagcttcttcgtcctcaacatgtttgta
ggggtggtggtggagaacttccacaaatgtcggcaacaccaagaggcagaagaggcccgg
cggcgggaagagaagcgcctgaggcgcctggagaagaagcgtaggaaagcacagcgcttg
ccgtattatgccacctactgctctgtccgcctcctcatccattcggtctgcaccagccac
tacttggacatcttcatcactttcataatttgcctcaacgttgtcactatgtccctggag
cactacaaccagccaatgtctctggagactgccctcaagtactgcaactacatgttcacc
actgtgtttgtcctggaagcggttttgaagcttgtagcctttgggctgagacgcttcttc
aaagacaggtggaaccaactggacctggccattgttctgctctcagtcatgggcatcaca
cttgaggagattgaaataaatgctgcccttcccatcaaccccaccatcatccgtatcatg
agagtgctgcgtattgcccgagttttgaagctcctgaagatggcgactgggatgcgagca
ttactggacacagttgtgcaagcactgccgcaggtggggaatcttggactgctcttcatg
ctcctttttttcatctatgctgctctaggagtggagctctttgggaaactcatttgcaac
gacgagaacccctgtgagggtatgagccgtcatgccacctttgagaactttgggatggcc
ttcctcacacttttccaggtctccactggtgataactggaatggaatcatgaaggacaca
ctgcgtgaatgcactcatgacgaccggagctgtctcagcaacctgcagttcatctcgcca
ctctactttgtcagcttcgtgctcaccgcccagtttgtcctcatcaatgtagtagtagct
gtgcttatgaaacacctggacgacagcaacaaggaagcacaagaggatgcagaaatggat
gctgagattgagctggagatggcccacgggctctgctcccgtaactgtggttcaccgagt
gctggacacgatggaggaggtgggagattggatcctggaggacagctgtgcatggcatgt
tactctcctgcacaggagaacttatggctggacagtgtctctttaattattaaggactcc
ttcgacggggagttaatgatcatcgataacctatcgggctccgtcttccatcattactcc
tcgccggccatgtgcgagaagtgtaaccatgacaagcaagaggttcagctggccgaaatg
gaaggcttgtcactcaactctgataagtcttccatcctgcttggggacgatggagacaac
aacagtgtcgatcagccaagccctaaggaggaggaggccaaggatggtgaagacagtcct
aactcggaggaatgtctcttccctttaacaaacatggaagcttctccaactccagaaagc
tacttgtgtgaagtggagaaaatctcgttcagtccagtccagtcttggctgaagaacgag
agcaacccaggtcctcccactcccttctctccagatccatccaatcccctgttaccattg
cgagcagagtttttcgtcccagctgtttctgccaatccaccaagtcaagagaaagcttcc
tgcccagagagcctcccaaaaatctctttgcaagcttcctgggcgtctctgcaatctcca
ggtgtccactgctcacttatccaccagaccacagagagcgacacctccctggaagactgc
aggagcaacagttcggaaggcagcttgcagaccacactggaggacagcttaaacctcagt
gactcgccccagtgcaccctggacctcccagttgcactatgcccagtgccagccacagcc
accaaaaaagccttggtggcgcctctttcccctgcctcccgcaggcagagcttgaggggc
cgtgggatcttcactctccggaacatcagccggcaccagcggagccacagcagtggcggg
agcacgagccccggctgcacttaccatgactccatggacccttcggacgaggagggcgca
gggagcagcctgagaggcggaggcaacaacagcgagcagtcagagaccctcagcagtctc
tctctgacctccctcttctcgccgccccctccgccccaaggtctggcgcttgtgaagaag
tgcaacagcaccagcagtctccatgccaacccttcctcccggggctccgcagcaaccgac
agcaagcagttctactctgttgaccccaggggttttttatccatgccctcgtgggtgacg
gacttctgcaagaacagcccctctccgcgggagggcaacgtaccagagggctcggacagg
attgagaccgcaggccacagctccccgattccttccgagttgcagctggggagcggagtc
agcaagaggaatagatga

DBGET integrated database retrieval system