KEGG   Podarcis muralis (common wall lizard): 114606130
Entry
114606130         CDS       T06059                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmua01002]
    114606130 (ERAP1)
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     114606130 (ERAP1)
Peptidases and inhibitors [BR:pmua01002]
 Metallo peptidases
  Family M1
   114606130 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1759
Other DBs
NCBI-GeneID: 114606130
NCBI-ProteinID: XP_028603764
Position
11
AA seq 931 aa
MFLLLVILSLVPFLSCNLNSQRTGSSTGDGSNQFPWNKSRLPKHVVPVHYDLLIHPNLTT
LTFTGLAKIEIMVIEQTSSVILHSKYLQITKATIQGATGSPDADKEVTVLEYPPYEQIAL
VATEPLQIEHKYIISIEYSANLSDSFHGFYKSSYRTPEGEVRVLAATQFEPTAARMAFPC
FDEPAFKAKFSIKIIREPKHLALSNMPIVESVNIGGQLIEDRFDVSVKMSTYLVAFIVSD
FKSVSKMTSRGIKVSVYAVPHVINQLDYALDAAVKLLDFYEGYFSIPYPLPKQDLAAIPD
FQSGAMENWGLITYRESALLYDPEKSSASSRLGITLVIAHELAHQWFGNLVTMEWWNDLW
LNEGFANFMEFVSVNVTHPELKVEDHFLNNYFSAMDVDALNSSHPISTPVEDPSQILEMF
DSVSYEKGACLLNMLLHYISPEVFRAGIIKYLSQFSYQNTENKDLWNSLSGVCPAKEAGR
GQNDGVCSRSQEPVSTSHWTQNGLHDVKTMMDTWTLQKGFPVVTVTLEGKKVHLHQEHYV
KASSSSAPTGNLWHVPLTYITSKCAEVQKFLLTAKTDDIILPEEVEWIKFNVGMNGYYIV
HYGDDGWDALIRLLKENHKAISSNDRASLINSVFQMVSAEKLSITKALDLTIYLQRETEI
TPVLEGLDELIPLYKLTEKRDMKDIDNQLKGYIINLMKNMIDKQSWDDAGTVSERLLRSS
LLVFACVRKYQPCVDKAKEFYTKWKDSDGNFHLPNDIKFAVYAVGAQTDEGWDFLFGKHK
LPKFNTEKRIIESVLSLSPNKEKLEWLMQQGLQDDLIKMQDLPYIVLSVGRNPEGYQLAW
KFLKQNWQTFVKKFELGSNTISHLVTGLTNKYSTKEQLEEVKSFFNSQGKKVSELRAVYQ
AIETIEENIQWMDKNLEKIKEWLHTNSRTSI
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgtttctattgctagtcattttaagtcttgttccatttttgagctgtaatctcaatagc
caaagaacaggttcatccactggagatggaagtaatcaatttccttggaataaaagtagg
cttcccaagcatgtagtcccagttcattatgatcttcttattcatccaaatctcaccact
ttaacttttactggattggccaaaatagagattatggtaattgaacaaactagctcagtc
atcctgcacagcaaatatctccagatcaccaaagctaccatccaaggagcaacaggatcc
cctgatgcggataaagaagtgactgttttagaatacccgccatatgaacagattgcactc
gttgctactgaaccactgcaaattgagcacaagtacattattagcattgagtattctgct
aatctctcagacagttttcatggattctataaaagctcatatagaactccagaaggagaa
gtaagggtgcttgcagcaacacagtttgaaccaacagctgcacgtatggctttcccttgc
tttgacgagcctgcattcaaagctaaattttctattaagatcataagagaaccgaaacat
cttgcactatccaatatgcccattgtggaatccgtaaacatcggagggcagctcattgaa
gaccgttttgatgtcagtgtaaagatgagcacttacctagtggccttcattgtttcagat
ttcaaatccgtttccaagatgacttcccgtggaattaaggtttcagtatatgctgtacca
catgtgatcaaccaactggattatgccttggatgcagcagtaaaactgttagacttctat
gagggatattttagcattccatatcctctgcctaagcaagaccttgcagctattcccgat
tttcagtctggtgcaatggaaaattggggattgattacatacagggaatctgctttgtta
tacgatcctgaaaaatcctcagcgtcaagtagacttggaattaccttggttatagcccat
gaacttgctcaccagtggtttggaaatctagtcaccatggaatggtggaatgatctctgg
ctcaatgaaggatttgcaaattttatggaatttgtgtctgtaaatgttacccacccagaa
ctgaaagttgaagatcattttttaaacaattatttctctgctatggacgtagatgcctta
aattcttcacatcctatatcgacccctgttgaagatccatctcagattctagaaatgttt
gatagtgtttcctatgagaagggtgcttgtcttctaaatatgctactgcattatatcagc
ccagaagtgtttagagctggaattataaaatatctgtcacaattcagctatcagaacaca
gaaaacaaagatttgtggaacagcttgtcaggtgtttgccctgcaaaagaagcaggtcga
ggacaaaatgatggggtttgtagcagaagccaggagccagtctcaacttcccactggacc
caaaatgggcttcatgatgtgaagaccatgatggacacttggacactgcagaaaggattc
ccagtggtaactgtgacattagaagggaagaaagtccatctacaccaagagcactatgtg
aaggcttctagttcttctgcaccaaccgggaatctgtggcatgttccattaacgtatatt
accagtaaatgtgctgaagttcagaagtttttgctgacagctaaaacagatgacatcatt
ctcccagaagaagtggagtggataaaatttaatgttggaatgaatggttattatattgtg
cactatggagatgatggatgggatgccctaattcgtcttttgaaagaaaaccataaagca
attagcagcaatgatagagcaagtctcatcaatagtgtgttccagatggtgagtgccgaa
aagctgtcgattactaaagctcttgatttaacaatatacctacaacgtgaaactgaaatt
actcccgtgcttgaaggattggatgagctgatacctttgtacaaacttacggagaagagg
gacatgaaagacatagataatcaattaaagggatacataatcaatctaatgaaaaacatg
attgacaaacagtcttgggacgatgctgggacagtgtctgagcgactacttcggagcagt
cttctggtgtttgcttgcgtacgaaagtaccaaccgtgtgtggacaaagcaaaagagttc
tatacaaagtggaaggactccgatggaaatttccatttgcccaatgacatcaagtttgcg
gtatatgctgttggagcacagacggacgaaggctgggacttccttttcggcaaacacaag
ctgccgaaatttaatactgagaaaaggataattgaatctgttctcagcctaagcccaaat
aaggagaagcttgaatggttaatgcagcaaggtttacaggatgacttaataaaaatgcag
gatcttccatatattgttctctctgttggaaggaaccctgagggttatcagttagcctgg
aagtttctaaagcagaattggcagacatttgtaaaaaagtttgaacttggttcgaatacc
atttcacacctggttactggattgacaaataaatattccacaaaggaacaacttgaagaa
gtaaaaagtttcttcaactcccaaggcaaaaaagtttcagagctccgtgctgtctaccaa
gcaatagaaaccattgaagaaaatattcagtggatggataagaaccttgaaaaaatcaag
gaatggttacacaccaatagcagaacaagcatctaa

DBGET integrated database retrieval system