KEGG   Podarcis muralis (common wall lizard): 114606323Help
Entry
114606323         CDS       T06059                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114606323 (DOCK8)
Membrane trafficking [BR:pmua04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    114606323 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 114606323
NCBI-ProteinID: XP_028604262
Position
11
AA seq 2037 aa AA seqDB search
MQLNNLDLELLQELGDFPEDDLEVVFTPKEHRTLQPSLPEEGAELDPHVRDCIQTYIRDW
LIVNRKNQGSNETFILMKRGSRSDFHKSLQKQTFESEVLDDSDSNYQTAPRHLKVLCDDS
SRATLTSGDFDLRSLQPDARLADLLQHISAEDFRRQNEEQRRANRPAELFALYPNIDEED
AVEIRPVPECPKEYLGNRILVKVQTLKFEIEIEPLFASLALYDIKERKKISENFHCDLNS
EQFKGFLRSHVPCIDSSSQARSAVFSVTYPSPDIYLVVKIEKVLQQGEIGDCAEPYLVLK
ESEVGKTKEKIEKLKVHAESFCQRLGKYRMPFAWVPINLANFFSVSTLERDIAELEVLNG
KGSTGDRKSMAMQGRRLSERSLGLEDVPALPTFKNTTLTFSTFFKQEGDRLTDEDLFKFL
ADYKRSSSLQRRVKSIPGLLKLEISPASEGLSCCLSPELLLVKPFPENRSRPHKEILEFP
VREVYVPHTVYRNLLYVYPQRLNFANRLASGRNITIKIQFMCGEDPACAMPVIFGKSSGP
EFVAEVCTPVTYHNKSPDFYEEVKIKLPAKLTEKHHLLFTFYHISCQPKQGACVETLLGY
SWLPILLNDRLQTGHYCLPVALDRLPANYSMHSAEKVPPQSPPVKWVEGHKGVFNIEVQG
ISSVHTQDNHLEKFFILCHALESQVAFPIRVLNEKITETTLEHELKLSIICLHSSRLEPL
VLFLHLVLDKLFQLAVQPMVIAGQTANFSQFAFESAAAIVNSLHNSKDLSKDLHGRNCLL
ASYVYYVFRLPEVQRDAIRLGATGSTNLAESRYYTYGRTTAFSVGSRLLQSRATSCSNPD
IAGTQASTDEEVRNIMSSKVADRSFNRMSCYSEPTSDMSSPCGSPRPSNKKHFHEELALQ
MVVSTGIVRESVFKYAWFFFELLIKSMAQYIDNMNKQDTPRRSRFSNRFKDDITTIVNVV
TSEIAALLVKPQKESEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSNKLNTLP
TLISMRLEFLQILCSHEHYLNLNLFFMTSGSAPTSPSPSLSSQNSSSCSSFQDHKFANMF
DLTAEYRQQHFLTGLLFTELAAALDTEAEGISKVQRKAVSAIHSLLSAHDLDKSCLKPEV
KVKVAALYLPLVGIILDALPQLHDFTVSDGRNGKGRIGSPDEEQEAASQINQNIALAIAG
NQFNLLRSYGSSVSTVPYKQYNTLSPETTRHLLICFLWIMKNADQNLIQKWVADLPSMQL
NRILDVLYICVSGFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMKRCRM
PAGNDKFPGFNENLRWRKEQTHWRQANERLDKTKAEIDQEVLVSGNLATEANLIILDMQE
NIIQATSAMDCRDNVLGGVLKVLVNSLTCDQSTTYLTHCFATLRALIVKFGELFFEEEVE
QCADLCQRLLQHCSSSMDTTRIQACATLYLLMRYSFSCISNFARVKMQVTMSLASLVGKA
SDFNEEYLRKSLRIILAYAEEDVDMQPTLFPGQVEELLYNLNSILSDTVKMREFQEDPEM
LMDLMYRIAKGYQTSPDLRLTWLQNMAEKHAKKKCYTEAAMCLVHAAALVAEYLSMLEDH
SYLPVGSVSFQNISSNVLEESAVSDDVLSPDEDGVCSGRYFSENGLVGLLEQAAELFNTG
GLCETVNEVYKIVTPILEAHRDFRKLSSTHSKLQKAFESIINKGQKRMFGTYFRVGFYGA
IFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGEDRIVVIKDSTPVDKSKLDPSKAY
IQITFVEPYFDDYEMKDRVTHFEKNFNLRRFMYTTPFTRDGRPRGELSEQYKRKTILTTM
HAFPYIKTRINVIQKEEFVLMPIEVAIEDMQKKTLELAVATRQVPPDPKMLQMVLQGSVG
ATVNQGPLEVAQVFLAEIPEDPKLYRHHNKLRLCFKEFIMRCGEAVEKNKCLITADQREY
QQELKKNYNKLKENLRPMIERKIPELYKPIVKVNSISRGSFLNSSFRKYENLPPQNS
NT seq 6114 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaataacttggatttggaactcctgcaagaacttggtgactttcctgaagat
gatttggaggtagtctttactccaaaggagcacaggaccttgcagccatcattgccagaa
gaaggggctgagttggatccgcatgtccgggattgtattcagacctatattcgtgactgg
ctgattgtgaatcgaaaaaaccaaggaagtaatgagacattcatcttaatgaaaagggga
tcccggagcgatttccacaagtcccttcaaaagcaaacatttgaatctgaagttttagat
gacagtgattcaaattatcagacagctcccaggcatttaaaagttctctgtgatgactcc
agtcgagccacactgacatctggggactttgacctgcgcagcctacagccagatgctcgt
ctggcagacctgttgcagcacattagtgcagaagactttcgaaggcaaaatgaggagcaa
cgacgagccaacaggcctgcagaactgtttgcactgtatcccaatatagatgaggaggat
gctgtggaaatacgtccggtgcctgagtgccccaaggaatatctgggcaataggatattg
gtgaaagtacagactctgaaatttgagatagaaattgagccattattcgcaagcttagcc
ctctatgatataaaagaaaggaaaaagatctcagaaaattttcattgtgacttgaactct
gaacaattcaaagggttcttgcgatcacatgtaccatgtattgactcatctagtcaggca
aggtctgcagtattttctgtaacatatccatctccggatatctatctagtagtgaagatt
gaaaaagtccttcaacaaggcgaaattggagattgtgcagaaccctacctggttctaaaa
gaaagtgaagttgggaagactaaagaaaaaattgagaaattaaaagtgcatgctgagtcc
ttttgccaacgtttgggaaagtatcgtatgccttttgcttgggttccaataaatttagca
aatttcttcagtgtttcaacacttgaaagagatatagcagagttagaagttttaaatggc
aaagggtccactggtgacagaaaatcaatggcaatgcaaggtagaagactttctgaaaga
agtcttggattggaggatgttcctgccttgccaaccttcaaaaacaccactctgactttc
agcacattttttaaacaggaaggagatcggctgactgatgaagacttattcaagttctta
gctgattacaagagatcgtcttctttgcagagaagagtgaaatctataccaggattgctc
aagttggagatctcccctgcttcagaaggtctcagttgctgtctcagcccagagttgttg
ctggtgaagccattccctgaaaaccgcagtcggcctcataaagagattctggagtttcca
gtgcgagaagtctatgtcccccatactgtatatagaaatcttctatatgtgtatccacaa
cggctgaattttgcaaaccgcctggcttcaggccggaatattaccattaagatacagttt
atgtgtggagaagaccctgcctgtgcaatgccggtcatttttgggaaatcctcaggtcca
gaatttgttgcagaagtttgcacacctgttacatatcataacaaatctcctgatttctat
gaagaagtgaaaattaagctgccagctaaactcacagaaaaacatcacctgctattcaca
ttttaccacatcagttgtcagccaaagcaaggagcctgtgtagaaactctcctgggatat
tcatggctgccaattctgttaaatgatcgtctccagacaggccattattgcctccctgtt
gccttggatagactgcctgccaactattccatgcactcagcagagaaagttcctccacaa
tctcctccagttaaatgggttgaaggacacaagggagtgtttaatattgaagtgcaaggt
atatcatcagttcacacacaggacaatcacctggagaaattcttcatcctgtgccatgca
ctagaaagccaagttgcattccccattcgagtgctgaatgagaagatcacagaaaccact
cttgaacatgaactaaaactcagcattatctgcttgcactcctcccgcctggagcccctt
gtgttgtttttacacttggttttggataaactcttccagttggctgtccagcccatggtt
atagctggccagacagccaacttctcccagtttgcttttgaatctgcagctgcgatagtg
aacagcctccacaacagcaaagacttgagcaaggacctgcatggcagaaactgtctccta
gcatcttatgtctactatgtcttccgccttcctgaagtacagagagatgctatcaggcta
ggtgcaacaggcagcactaacctggctgaatctcgttattacacttatggccgtaccaca
gctttctccgtgggctctcgactcttgcaaagccgggcaacaagctgcagtaatccagac
attgctgggacacaggcttctactgatgaagaagtcagaaacatcatgtcttccaaggtt
gcagatcggagctttaaccggatgtcttgctatagtgagcccaccagtgatatgtcaagc
ccctgtggaagccctcgaccgtccaataaaaagcacttccatgaagagttagcacttcaa
atggtagtcagcactggcatcgtgagagaatctgtcttcaagtatgcttggttcttcttc
gaattgttgatcaagagcatggctcagtatattgataacatgaacaaacaggacacgccc
cgccgaagtagattttccaatcgcttcaaggatgacatcaccactatagtgaatgtggtc
acctcagagattgcagcacttttagtcaaacctcagaaggaaagtgaacaagcagaaaag
atcaacattagcctagcatttttcctgtatgatcttctatctctcatggatcgtggattt
gtctttaacctcatcaaacactactgcaatcagttgtcaaataaacttaacactcttcca
acactgatttccatgaggctggagtttctccaaattctctgcagtcatgaacattacctc
aatttgaatctcttctttatgacttcaggatctgctccaacatctccctctccttctctg
tcatctcagaattcaagctcctgctcaagtttccaagatcacaaatttgccaacatgttt
gacctgacagcagaatatcggcagcaacacttcctaacagggttactcttcactgaactg
gcagctgccctggacacagaagcagaaggaataagcaaagtgcaaaggaaagctgtcagt
gccatccacagcctgctgagtgcccacgacttggacaaatcctgcttgaaaccagaagtg
aaagtgaaagttgctgccctttatctgccgctggttggaataattttggatgcacttcca
cagttacatgactttacagtttcagatggccgcaatgggaaaggccgcatcggatctcca
gatgaagaacaagaagctgcaagccaaattaaccaaaatattgctctggccattgctggg
aatcagtttaatctcctacggtcctatggttcatctgtgtccacagtgccttacaaacaa
tacaacactttaagtccagaaactacacgccaccttttgatctgtttcctgtggatcatg
aaaaacgctgatcagaatcttattcagaaatgggttgcagacctgccatctatgcagcta
aacaggattttagatgtcctttacatctgtgtctcaggctttgagtataagggcaagcaa
agctcagacaaagtcagcactcaagtactccagaaatcaagggatgtaaaagctcggcta
gaagaggccttactaagaggagagggagccaggggtgaaatgatgaagcggtgcaggatg
cctgctgggaacgataaattcccaggatttaatgagaatctacgatggaggaaagagcag
acacactggcggcaagcaaatgagaggctagataaaacaaaagctgagattgaccaagaa
gtgttggttagtgggaacctagccacagaagctaatctgattatcctagacatgcaagag
aacatcatccaggcgacttcagctatggattgcagagataatgtcttgggaggtgtgttg
aaagtccttgtaaattctttgacctgtgatcagagcacaacctacttgactcattgcttt
gctactctccgagcattaattgtcaagtttggagagttgttctttgaagaggaagtggag
cagtgtgctgacctgtgtcaaagactccttcagcactgcagcagcagcatggataccact
cggattcaagcctgtgctactctttacctccttatgagatacagcttcagctgcataagt
aactttgcaagagtcaaaatgcaagtgacaatgtcattggcttctctggttggtaaagca
tcagattttaacgaggagtatctcagaaagtctttacgaattattttggcatatgcagag
gaagatgtagacatgcagccaactctcttcccgggacaggtggaagagctgttgtataat
ctgaacagcatattgtcagacacagtgaaaatgcgagagtttcaggaagatccagagatg
ctcatggatcttatgtacagaattgccaaaggatatcagacatcacctgacttaaggttg
acctggctccaaaacatggcagagaagcatgctaagaaaaaatgttacacagaggctgcc
atgtgtctagttcatgctgctgctcttgttgctgaatacctgagcatgctggaagatcac
agttacctgccagttggcagtgtcagctttcagaatatttcctccaatgtgcttgaggag
tctgctgtttctgatgatgttctgtctccagatgaagatggagtgtgctctggaaggtat
ttctcagagaatggtttggtgggactgctggaacaagctgcagagctttttaacactgga
ggactgtgtgaaactgtgaatgaggtctacaagattgtcacccccatcttagaagcacat
cgagatttcaggaaactttcttccactcacagtaaacttcagaaagcctttgagagcatc
ataaataagggtcagaagagaatgtttggcacttacttccgtgttggcttctatggagcc
atatttggagatttagatgaacaggaatttgtttacaaagagcctgccattaccaaactt
cctgagatttctcatagactggagggcttttatggtcagtgttttggggaggatcgcatt
gtagtgattaaagattctactccagtagacaagagcaagctagatcccagtaaggcctac
atacaaattacctttgtggaaccctattttgatgactatgagatgaaagacagagtgacc
cattttgagaaaaacttcaacctccgacgatttatgtataccacccctttcactcgggat
ggacggccacgaggagaattgagtgagcagtataagaggaagaccattttgaccacaatg
catgctttcccctacatcaaaactagaatcaatgtcattcaaaaggaggagtttgttttg
atgccaattgaagtagctattgaagacatgcaaaagaaaacgcttgaactggctgttgcc
accagacaggtgccaccagatcccaaaatgctgcagatggtgcttcaaggttctgtgggg
gccacagtaaatcagggaccactagaagtagctcaagtgttcctggctgaaattccagag
gatccaaaactttatcgacatcacaacaagctgaggttatgcttcaaagaattcataatg
agatgtggtgaagcagtggagaaaaataaatgtctgattactgctgaccaaagggaatat
caacaagaactgaaaaagaactacaacaagttgaaagagaacctcagaccaatgattgag
aggaagatcccagagctgtataaacctattgtgaaagttaacagtatttcaaggggctct
ttccttaattctagttttaggaaatatgaaaatctgcctccacagaacagttaa

DBGET integrated database retrieval system