KEGG   Podarcis muralis (common wall lizard): 114606552Help
Entry
114606552         CDS       T06059                                 

Definition
(RefSeq) probable glutathione peroxidase 8-B
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00480  Glutathione metabolism
pmua00590  Arachidonic acid metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    114606552
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114606552
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     114606552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 114606552
NCBI-ProteinID: XP_028604789
Position
11
AA seq 212 aa AA seqDB search
MEPPLPLPLTACSLKSSRLKTRVLIIFFSMVLFTAILGLLQLKYLKPKDFYSFEVMDPKG
RTVSLEKYRGKASLVVNVASYCQHTEKNYIMLQELHREFGPYHFTVLAFPCNQYGEMEPD
TSRRIEYLAKSNYRVTFPIFKKIKILGSEASPAFQFLIDSSKAMPRWNFWKYLINPDGKV
VKFWGPEEPIESIKPDIAALVRQIILKRREDL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcctctgcctctgcctctgacagcgtgttctttgaaaagctcgaggctgaaa
accagggttttaatcattttcttctctatggttttgttcacagccatactcggcctgctg
caacttaagtacttaaagcccaaagacttttattcctttgaagtgatggatccgaaaggc
aggaccgtttcgttggagaaatacagaggcaaagcgtctctggttgttaacgtggctagt
tactgccagcacacagaaaaaaattacatcatgctgcaggaactgcacagggagtttgga
ccataccacttcacagtactagccttcccctgtaatcagtatggggaaatggagccagac
acaagccggcggattgaatatcttgcaaaatcaaattacagagtaactttccccattttc
aagaaaataaagattctaggaagtgaagcatcgccagcatttcaatttctaatagattcc
tccaaagctatgcctcggtggaatttctggaagtatctcatcaacccagatgggaaagtc
gtgaagttctggggacccgaagagcccatagaaagcatcaagccagatatagctgctctg
gttaggcagatcattttgaaaagaagagaagacctctga

DBGET integrated database retrieval system