KEGG   Podarcis muralis (common wall lizard): 114607156Help
Entry
114607156         CDS       T06059                                 

Gene name
VPS41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114607156 (VPS41)
Membrane trafficking [BR:pmua04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    114607156 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_1 Vps39_2 ANAPC4_WD40 zf-RING_2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 114607156
NCBI-ProteinID: XP_028605910
Position
12
AA seq 854 aa AA seqDB search
MAEAEPQEPRCNEESTDESEEDDSEEEPKLKYERLSNGVTEILQKDVASCMMVHEKFLAL
GTHYGKVYLLDVQGNITQKFDISPVKINQISLDESGEHMGVCSEDGKVQVFGLYTGEEFH
ETFDCPIKIVAVHPQFVRSHCKQFVTGGNKLFLYEKSWMNRWKPSVLHEGEGNIRNVKWR
GNLIAWANNMGVKILDVIAKQRITNVPRDDINLRPDMYPCSLCWKDNLTLIIGWGNSVKI
CSVKERHASEMRDLPSRYVEIVSQFNTEFYISGIAPLCDQLVILSYVKEISEKTEKECCS
RPRLDIIQPFPESCEEISSDALTVRRFQENECRDYCLEYSEGESLFYIISPRDVVVAKER
DQDDHIEWLLEKKKYEEALMAAEISQKTMKKHKIQDIGLAYINHLMEIGEYDLAARKCQK
ILGKNTDLWEFEVHRFKEIGQLKAISRYLPRRDSVLKPFIYEMVLHEFLESDYEGFATLI
KEWPGNLYNNAIIVQAVVDHLKKDPQNRTLLKTLAELYTYDQRYGKALEIYLTLRHKDVF
QLIHKHNLFSSIRDKIVLLMEFDSEKAVDMLLDNEDKISIDKVVEELKNRPELQHVYLHK
LFKRDHHKGQKYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLL
SRMGNSRSALKMIMEELYDVDKAIEFAKEQDDAELWEDLILYSIDKPPFITGLLNNIGTH
VDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQM
RGVLVDEENICETCLSPILPTDASKSFSVTVFHCRHMFHKECFPELSTDSSVHFCNICSA
KHRGPGSAILEMKK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcggagccgcaggagcccaggtgcaatgaagaatctacagatgagtctgag
gaagatgacagtgaagaggagcccaagctgaagtatgaaaggctttctaatggtgttacg
gaaattcttcaaaaggacgtcgccagttgcatgatggttcatgagaagtttttggcgctt
ggaacgcattatggcaaagtttatttactcgatgtccaggggaatatcacccagaagttt
gacattagtccagttaagataaatcaaattagcctggatgaaagtggagagcacatgggt
gtttgctctgaagatggcaaggtgcaggtgtttggattgtacacaggggaagaattccac
gaaacatttgattgccctattaaaattgtcgctgttcaccctcaatttgtgagatcacac
tgcaagcagtttgtaactggagggaacaaattgtttttatatgaaaagtcatggatgaac
agatggaaaccttcagttttacatgaaggagagggaaatatcagaaatgttaaatggaga
ggaaacctgattgcttgggccaataatatgggcgtgaagatactcgacgtgattgctaag
caaagaatcaccaacgtgccccgagacgatataaacctccgtcctgatatgtatccctgc
agcctttgctggaaagataatttaacactgattattggctggggaaattcagtaaagata
tgctcagtcaaagagcgacatgccagtgaaatgcgagatctgccaagtcgttacgtggaa
atagtttcccagttcaacactgaattttacatcagtggaattgcacctctctgtgaccag
cttgtcatactttcatatgtaaaggagatttcagagaaaactgaaaaggagtgttgttcc
agacctaggctggatataatccagccatttcctgaatcttgtgaagaaatctcctccgat
gccctaactgtgaggcgcttccaagaaaatgaatgccgtgattattgtttggaatattca
gagggtgaatcactgttttatatcatcagtccaagagatgttgttgtggccaaagaacgt
gaccaggatgaccatattgaatggctcttggaaaagaagaaatatgaagaggctttgatg
gcagctgagatcagccagaagaccatgaaaaaacacaagattcaggatataggtttggcc
tacataaaccatctgatggaaattggagagtatgacctggcagcacgaaaatgccagaaa
atacttggcaagaacacagatctctgggaatttgaggtgcacaggtttaaagaaattgga
caacttaaggcgattagccgctatttgccaagacgggattcagtcctgaagccttttatc
tatgaaatggtcctacatgaatttctggaaagcgactatgagggttttgcaacattaatt
aaggagtggcctgggaacctttataacaatgcaatcattgtccaagcagtggtggatcat
ctgaagaaagatccacagaacaggactttgctgaaaacgcttgcagagttgtacacctat
gaccaacgctacggaaaggcccttgaaatttatctcacactgagacataaagatgttttc
cagctgatccacaaacacaatcttttcagctccatcagggacaaaattgttctgctaatg
gagtttgattcagagaaagcagttgacatgcttttggataatgaagacaagatctctatt
gataaagtggtggaagaattaaaaaacaggcctgaactgcagcatgtgtacctgcacaag
ctgttcaagagagaccatcacaaaggacaaaagtaccatgagaaacagatcagtctgtat
gctgaatatgaccggccaaatttacttccgtttctcagagacagcactcattgcccttta
gaaaaggctcttgaaatctgtcagcaaaggaactttgtagaagagacagtttatcttttg
agcagaatgggcaatagtcgaagtgctctgaagatgatcatggaggaattatatgatgtg
gataaggctattgaatttgctaaggagcaagatgatgcagaactgtgggaagatctcatc
ttgtactccattgacaaaccaccttttattaccggcttgttaaataacattgggacccac
gttgaccccatcctcctgatccaccgcattaaggaaggcatggagattccaaacctgaga
gattcactggtaaaaattcttcaggattataacttacagattttgctccgggaggggtgc
aagaagattcttgttgctgactcgctttccttgctgaaaaagatgcaccgaacacaaatg
agaggagtccttgtggatgaggagaatatatgtgaaacatgcctttcccctatactgcct
acagatgcatctaaatctttcagtgtaacagtgtttcactgcaggcatatgttccacaaa
gagtgttttcctgaacttagcacagattcgtcggtacacttctgtaacatctgcagtgct
aaacacagaggtccaggcagtgccatcttggagatgaaaaaataa

DBGET integrated database retrieval system